SecReT6
Protein ID: 134293816
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5136
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2043603..2044244 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA4JP84
KEGG IDbvi:Bcep1808_5136
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.40E-41, Aligned region: 27..176
Protein Sequence: 213 a.a.     [Download]
>gi|134293816|ref|YP_001117552.1| hypothetical protein Bcep1808_5136 [Burkholderia vietnamiensis G4]
MDNNQMNILRIPIGRSLAGAVATVVVVATAGCGVGQAVKDSTVDAAKWAFTTQVKTMNLDLVARSSLNAN
AAGQPLSTVVRLYQLKDAKTFEQLDYTQLQTNDLDVLKADLLATKDVVLRPGASASVVEPMNPDAQVVGV
VAFFREPWDGAVWKLAVPKKQWKKTDPVKIEVRDNTLVLVDAKDRPIVRSAPQQSAPAPKPKASVQPGTQ
DEG
 
Nucleotide Sequence: 642 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c2044244-2043603 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGGACAACAATCAGATGAACATTTTAAGGATACCGATTGGACGAAGCCTGGCCGGTGCAGTGGCCACCG
TGGTGGTCGTTGCGACCGCCGGTTGCGGCGTCGGCCAGGCCGTGAAGGACAGCACGGTGGACGCTGCGAA
ATGGGCCTTCACGACGCAGGTGAAGACGATGAACCTGGACCTCGTCGCCCGCTCGTCGCTCAATGCCAAC
GCAGCGGGGCAGCCGTTGTCGACGGTGGTGAGGCTCTATCAGTTGAAGGACGCGAAGACCTTCGAGCAGC
TCGACTATACCCAGTTGCAGACCAACGATCTCGATGTGCTGAAGGCGGATCTGCTTGCGACCAAGGATGT
CGTGTTGCGCCCGGGCGCGAGCGCCAGCGTGGTCGAGCCGATGAACCCGGACGCGCAGGTGGTCGGCGTC
GTGGCGTTCTTCCGTGAGCCGTGGGACGGCGCGGTGTGGAAACTGGCGGTGCCGAAGAAGCAGTGGAAAA
AGACCGATCCGGTGAAGATCGAGGTGCGCGACAACACGCTTGTGCTGGTCGACGCGAAGGACCGGCCGAT
CGTGCGATCGGCGCCGCAGCAGAGCGCGCCGGCGCCGAAGCCGAAAGCGTCGGTGCAGCCCGGTACGCAG
GATGAGGGTTGA