SecReT6
Protein ID: 134293817
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5137
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2044291..2045307 [-]
Producthypothetical protein
NoteTssG
UniProt IDA4JMA6
KEGG IDbvi:Bcep1808_4443, bvi:Bcep1808_5137
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-83, Aligned region: 8..312
Protein Sequence: 338 a.a.     [Download]
>gi|134293817|ref|YP_001117553.1| hypothetical protein Bcep1808_5137 [Burkholderia vietnamiensis G4]
MLLPALLDQAHRMNFYRFCALIELASPDAAPLGATDSPATDPVRFRSRGQLGFPAREIDAVEYDADDPAK
PVAVRTTFLGLYGVDARMPTYFVDEVAQNRDGAEPLSAFLDLFHHRIATQFYRIWRKYRYPAGFRPDGFD
TVSRGVLSFVGLGFRSPDTHAPDWGLPQGVGARTLLSMLGLAAQKTRTAEGLAGVLTHAIPDAAIDVEEF
YPVWRTVNDFEPAALGEQCLLGRGFYDRANTVRIVITPHTRESVTALVPGQPAYRQITALLRFYLGYESE
ALLEMQVHPDLMPEPLLAAGQANLGLTTQLGSPPAVGRGPTRVTRVQLGRWSGATETV
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c2045307-2044291 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGTTGTTGCCGGCGCTGTTGGATCAGGCGCATCGGATGAATTTCTATCGCTTCTGCGCGTTGATCGAAC
TGGCGTCACCCGATGCAGCGCCGCTCGGCGCCACCGATTCGCCCGCGACGGATCCGGTCCGGTTCCGCTC
ACGTGGCCAACTTGGGTTTCCGGCGCGCGAGATCGATGCAGTCGAATACGACGCGGACGATCCGGCGAAG
CCGGTTGCGGTGCGTACGACGTTCCTCGGTCTGTACGGCGTCGACGCGCGGATGCCGACGTACTTCGTCG
ACGAAGTGGCGCAGAACCGCGACGGCGCCGAGCCGCTGTCGGCGTTCCTGGACCTGTTCCACCATCGTAT
TGCGACGCAGTTCTACCGGATTTGGCGCAAGTATCGCTATCCGGCCGGTTTCCGGCCGGATGGCTTCGAC
ACGGTCTCCCGCGGTGTGCTCAGCTTTGTCGGTCTTGGGTTCCGGTCGCCGGACACACATGCGCCTGACT
GGGGGCTGCCGCAGGGCGTTGGTGCACGAACGCTGCTGTCGATGCTCGGACTAGCCGCTCAGAAGACGCG
TACCGCGGAAGGGCTCGCCGGCGTGCTGACACATGCGATACCGGATGCCGCGATCGACGTGGAGGAGTTC
TATCCGGTGTGGCGTACCGTCAACGATTTCGAGCCTGCAGCGCTCGGCGAACAATGTCTGCTCGGACGCG
GATTCTACGATCGGGCGAACACGGTACGCATCGTGATCACGCCGCACACGCGCGAATCGGTCACCGCGCT
GGTACCCGGGCAACCGGCATACCGACAGATCACCGCGTTGCTGCGCTTCTACCTCGGCTACGAAAGCGAA
GCGCTGCTCGAGATGCAGGTGCATCCTGACCTGATGCCGGAACCGTTGTTGGCCGCCGGTCAGGCGAACC
TCGGCCTGACCACGCAGCTCGGGTCGCCGCCTGCGGTAGGGCGCGGACCCACTCGCGTGACACGGGTGCA
GCTGGGGCGCTGGAGCGGGGCGACGGAAACCGTATAA