SecReT6
Protein ID: 134293826
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5146
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2056330..2058813 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA4JP94
KEGG IDbvi:Bcep1808_5146
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-41, Aligned region: 51..345
Phage_GPD [PF05954], Evalue: 1.50E-41, Aligned region: 568..599
DUF2345 [PF10106], Evalue: 1.50E-41, Aligned region: 599..751
T6SS_Vgr [PF13296], Evalue: 2.40E-36, Aligned region: 478..584
Phage_base_V [PF04717], Evalue: 8.70E-08, Aligned region: 376..469
Protein Sequence: 827 a.a.     [Download]
>gi|134293826|ref|YP_001117562.1| Rhs element Vgr protein [Burkholderia vietnamiensis G4]
MSNLFDDARRFVSDLTGVSGRQAYFFEVPGTESAVALSVVSVMAVERMGYPTEVRVVLTHPLQLARTDYL
NRDAVCTIVPDDGVPHRFSGFIARFSTLQTTADFTKYEIVLKSHFARLEAVSTSRIYQHQTTPQIIEAVL
RSHGLEGHQFAFRLRREYPKHLFRFQYKLDDLSYVRMLMQKAGIYSYIVETEHGDQAVFADDVDHYQWDP
HLTAAYRETAGLEATGAEAVTALKTHTVTVPQSFVVADYNPEQAWERFKDEANVAPQDQTTYGRPYVYGT
NHLDQDGAKWEAQLRHEAAIAWQVVYEGESNVLALQAGRVLNLDTVLPDAPDGQVVIEVTHSGARDRAYS
NSYIAIPANRRFRLQLEDAKWPKIAGTLSARVTSPDKYKYAYLTGAGYYTVRFDVDFADWPAGGESVPLR
LAKPFAGKLQTGFHFPALDNDEAVIAFRDADPDKPEIIGFHHHSQARDLVTSDRRWLSRNVIRTQSNNKL
RMDDWAGQEGIKLSTEHSGTSHLDLGYLVNQRLEYRGEGFELRTSGYGAIRAGKGLLVSADDQRDAEGKQ
LDMKAASTQLKEALQLMRSLEKAARSAQAQVNAVEQQRQLLAERLDRLQRAVLLATAPEGVAVTSGDHLQ
LSAKTNLTATAIENVDIGAGKNVSLSAANAVSIFAQNEGVKVVAAKNDIQAIAHSGQVLMTSAKDMKLVS
VEGELHAFSRNAVVISSGGAYIKLSGGNIELGCPGSIIFKRAGTFAQGPASLHESYPPLANSGPNSRKFV
LHYDGHPDDVIKGQRYRIHKENGAVIEGVSNDSGETSVAQSEIAEVVRIELLGKDKS
 
Nucleotide Sequence: 2484 bp     [Download]
>gi|134292031|ref|NC_009255.1|:c2058813-2056330 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGTCGAACCTGTTTGACGATGCGAGGCGGTTCGTATCGGACTTGACCGGGGTGTCGGGGCGCCAGGCAT
ATTTCTTCGAGGTGCCGGGGACCGAGAGCGCAGTTGCACTCTCGGTCGTGTCGGTGATGGCGGTCGAGCG
GATGGGATATCCCACCGAGGTGCGAGTGGTGCTCACGCATCCGCTGCAGCTGGCCCGCACTGACTATCTG
AATCGCGACGCGGTCTGCACGATCGTGCCTGACGATGGTGTGCCACATCGTTTCTCCGGTTTTATCGCGC
GCTTCTCGACGCTGCAGACCACCGCGGACTTCACCAAGTACGAGATCGTGCTGAAGTCGCACTTCGCGCG
ACTGGAAGCGGTGAGCACCAGCCGTATCTACCAGCACCAGACGACGCCGCAGATCATTGAGGCAGTGCTG
CGCAGCCATGGCTTGGAAGGCCACCAGTTCGCATTCCGGCTGCGCCGCGAGTATCCGAAGCACCTGTTCC
GCTTTCAGTACAAGCTCGACGACCTGTCGTATGTGCGGATGCTGATGCAGAAGGCCGGCATCTACAGCTA
CATCGTCGAGACCGAGCATGGCGATCAGGCGGTGTTTGCCGACGACGTCGACCATTACCAGTGGGACCCG
CACTTGACTGCGGCGTATCGCGAGACTGCGGGGCTGGAGGCGACCGGCGCCGAGGCGGTGACCGCACTCA
AGACGCATACGGTGACCGTGCCGCAGTCGTTTGTCGTGGCCGATTACAACCCCGAGCAGGCGTGGGAGCG
GTTCAAAGACGAGGCGAACGTCGCGCCGCAGGACCAGACTACCTATGGGCGGCCGTACGTCTACGGTACG
AATCACCTCGATCAGGACGGCGCGAAATGGGAGGCGCAACTGCGCCATGAAGCGGCGATCGCGTGGCAGG
TGGTGTACGAAGGTGAGAGCAACGTGCTGGCGCTGCAGGCCGGGCGCGTGCTGAATCTCGACACGGTATT
GCCCGATGCACCCGACGGACAGGTGGTGATCGAAGTGACGCATAGCGGCGCGCGCGATCGGGCTTACTCG
AACAGCTACATCGCAATTCCCGCTAACCGGCGCTTCCGGCTCCAGCTCGAAGACGCGAAGTGGCCGAAGA
TTGCCGGGACGCTGAGCGCTCGGGTGACGAGCCCCGACAAGTACAAATACGCTTACCTGACCGGGGCAGG
CTACTACACGGTTCGATTCGACGTGGACTTCGCGGACTGGCCGGCGGGCGGGGAAAGCGTGCCGCTGCGG
CTGGCGAAGCCCTTCGCGGGCAAGTTGCAGACGGGCTTCCACTTCCCGGCGCTGGACAACGATGAAGCGG
TGATCGCGTTCCGGGACGCGGACCCCGACAAGCCGGAGATCATCGGCTTCCACCATCACAGTCAGGCGCG
CGATCTGGTGACGAGCGATCGCCGCTGGCTGTCGCGCAACGTGATCCGCACGCAGTCGAATAACAAACTC
CGGATGGACGATTGGGCGGGGCAGGAGGGCATCAAGCTCAGCACCGAGCATTCGGGTACGAGCCATCTCG
ATCTTGGCTATCTGGTCAATCAGAGGCTGGAGTATCGAGGCGAAGGATTTGAGCTTCGCACTTCCGGTTA
CGGCGCAATCCGGGCGGGCAAAGGCCTGCTTGTTTCGGCGGACGACCAGCGCGATGCCGAGGGCAAGCAA
CTCGACATGAAGGCGGCCTCGACGCAGCTCAAAGAGGCGTTGCAATTGATGCGAAGCCTCGAAAAAGCTG
CCCGTTCGGCCCAAGCTCAGGTGAACGCCGTCGAGCAACAGCGGCAGTTGCTTGCCGAGAGATTGGACCG
CCTACAGCGTGCGGTCCTATTGGCGACTGCGCCGGAAGGTGTAGCCGTCACTAGCGGCGATCACCTTCAG
TTGTCCGCGAAGACGAATCTTACGGCAACTGCGATCGAAAACGTCGATATTGGTGCGGGGAAAAACGTCT
CGTTGTCTGCCGCCAACGCAGTATCGATTTTCGCGCAGAACGAAGGGGTCAAGGTCGTAGCTGCGAAAAA
TGATATTCAGGCCATCGCTCATTCGGGCCAGGTGCTGATGACGTCCGCGAAAGACATGAAACTCGTCAGC
GTCGAAGGAGAGCTCCATGCGTTCTCCCGTAACGCAGTCGTCATCTCGTCTGGCGGTGCTTATATCAAAC
TATCGGGCGGCAATATTGAACTGGGGTGTCCGGGCTCGATCATTTTCAAGCGCGCCGGGACGTTTGCGCA
GGGGCCAGCAAGTCTGCACGAATCGTATCCGCCGCTCGCCAATTCTGGGCCTAATTCACGCAAATTCGTA
CTTCATTATGACGGCCATCCTGACGATGTCATAAAGGGGCAGCGCTACCGCATTCATAAGGAAAACGGGG
CGGTGATTGAAGGTGTGAGCAATGACAGCGGAGAAACGAGCGTTGCGCAAAGCGAGATCGCAGAAGTGGT
CAGAATTGAACTGCTCGGTAAGGATAAATCGTGA