SecReT6
Protein ID: 134293827
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5147
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2059004..2060425 [+]
Producthypothetical protein
NoteTssC
UniProt IDA4JP95
KEGG IDbvi:Bcep1808_5147
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-166, Aligned region: 47..469
Protein Sequence: 473 a.a.     [Download]
>gi|134293827|ref|YP_001117563.1| hypothetical protein Bcep1808_5147 [Burkholderia vietnamiensis G4]
MSHSSVIRPCQMQRPMSEGAQCDQYTDAKLSSEMRINTIACIDSDLIDWYLAELDDQLGRQLDAILHHCA
FQTLESTWRGLQFLVDRTDFRQNVKIEVLDVSKEALRQDFEDAPDIIQSGLFRLTYVGEYDMPGGQPIAA
IVSAFEFDHGGPDIALLRNISKVAAAAHMPFIGAVSPAFFGKTTMEAVAGIRDLPSWFERAEYLKWKGFR
ETEDARYIALTMPRFLARLPYGFDTMPVRAFNYTENVRESGRSAYLWTSAAFAFAVNIVRSFVRNGWCVQ
IRGPQAGGVINDIPAHRYDLGAGQLGKISTDALISETRENEFADIGLIPLSYTRNHDQTCFFSAHSTQRP
RSYDARDASANSRINARLPYIFLLSRIAHYLKLIQRENIGTTRDSRLLELELNTWIKSLVTEMTDPGDEL
QAAHPLRQAKVAVEDIEDNPGFFRIKLFIVPHFQIEGVDINLSLVSQMPKAKH
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|134292031|ref|NC_009255.1|:2059004-2060425 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGTCGCATTCCTCTGTTATCCGGCCATGCCAGATGCAACGTCCGATGAGTGAAGGCGCTCAGTGCGACC
AATACACCGACGCCAAATTATCTTCAGAAATGCGCATAAATACGATTGCGTGCATCGATTCCGATTTGAT
CGATTGGTATCTGGCTGAATTGGACGATCAACTCGGCAGACAGCTCGACGCCATCCTCCACCACTGCGCA
TTTCAGACACTCGAATCGACGTGGCGCGGCCTGCAATTCCTGGTGGATCGGACTGATTTTCGACAAAACG
TCAAAATCGAGGTGCTTGATGTCTCGAAAGAAGCGCTGCGTCAAGACTTCGAAGATGCACCGGACATCAT
CCAGAGTGGCCTGTTCCGGCTGACATACGTCGGCGAATACGACATGCCGGGCGGGCAGCCCATCGCCGCG
ATCGTCTCGGCCTTTGAATTCGATCACGGCGGCCCGGACATCGCACTATTGCGCAATATCTCGAAAGTCG
CGGCCGCGGCCCATATGCCGTTCATCGGCGCCGTCTCGCCTGCGTTCTTCGGGAAAACCACGATGGAAGC
CGTCGCAGGCATCCGCGATCTGCCGAGCTGGTTCGAGCGGGCCGAATACCTGAAGTGGAAAGGCTTCCGT
GAAACTGAGGATGCACGCTACATCGCGCTCACAATGCCGCGATTCCTTGCACGTTTGCCGTACGGATTCG
ATACGATGCCCGTGCGCGCATTCAATTACACCGAGAATGTCAGGGAATCTGGTCGCAGCGCATATCTGTG
GACAAGCGCGGCGTTCGCTTTTGCGGTCAATATCGTGCGCAGCTTCGTACGAAACGGTTGGTGTGTGCAG
ATTCGCGGCCCGCAAGCGGGTGGCGTCATCAATGACATTCCCGCGCATCGGTACGACCTCGGCGCCGGGC
AACTGGGTAAGATTTCCACGGACGCATTGATTTCGGAAACACGCGAGAATGAATTTGCCGATATCGGCCT
AATTCCCCTTTCGTATACCCGCAATCACGATCAAACGTGTTTCTTCTCGGCGCATTCAACGCAACGGCCG
CGATCTTACGATGCACGCGACGCCTCCGCGAATAGCCGGATCAATGCCCGTTTACCGTACATCTTCTTGC
TGTCACGGATCGCACATTACCTGAAGCTCATCCAGCGCGAAAACATCGGCACGACGCGCGATAGCCGATT
GCTGGAGCTCGAGCTGAATACCTGGATTAAATCGCTTGTCACGGAAATGACCGATCCCGGCGATGAACTT
CAGGCGGCACACCCGCTGCGGCAGGCCAAGGTCGCGGTCGAGGACATCGAGGACAACCCGGGGTTCTTCC
GCATCAAGCTGTTCATCGTCCCGCATTTTCAGATCGAGGGCGTCGACATCAACCTCTCCCTGGTTTCGCA
GATGCCGAAAGCGAAACATTGA