SecReT6
Protein ID: 134293828
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5148
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2060482..2061828 [+]
Producthypothetical protein
NoteTssK
UniProt IDA4JM93
KEGG IDbvi:Bcep1808_5148, bvi:Bcep1808_4430
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.50E-131, Aligned region: 18..445
Protein Sequence: 448 a.a.     [Download]
>gi|134293828|ref|YP_001117564.1| hypothetical protein Bcep1808_5148 [Burkholderia vietnamiensis G4]
MKITRPLWAKGIFMTPQHFQQQAIWEQYVHDRVARIASPDAWGAVHVALDSEALSVNRLQCTALGLRLPD
GTLIDSETADWLPAARSLDDVPTTVDSVTVLAGVALMDAQGGNCVEPGEKPARPRRVTREYKHVADLNGD
GQEEISVERNVVALLFDFEQAGDYVTCPIARLVRTPQGRFEQDKSFVPPCLFLSASDRLVHRAQRISEIL
SAKSASLAVRRKERSDQIADFAVSDVALFWLLHSVNSTWPELARLVQAPDQHPERLYAVLARLAGSLLTF
STTESLQAIPLYDHHAPEPMFAELESLIRTLLDAVIPSRVVPIALERVRATTWLGRINDERLTEGAEYYL
SVQAAMPAHALIEHLPRLCKVGAPDEVEQIVNSALLGIALRPMSRLPAAIPVRIENQYFALDSNDAAFKR
MIDAHACQIYVPASIPEASLELYAVLPS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|134292031|ref|NC_009255.1|:2060482-2061828 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGAAGATAACCAGACCGCTGTGGGCCAAGGGGATTTTCATGACGCCGCAGCACTTCCAGCAGCAGGCGA
TATGGGAACAATACGTCCATGACCGTGTAGCACGTATCGCGAGCCCCGACGCTTGGGGTGCCGTCCACGT
TGCGCTCGACAGCGAAGCACTGAGCGTCAATCGACTGCAGTGCACGGCGCTCGGGCTGCGCCTGCCGGAC
GGTACGCTGATCGATAGTGAAACGGCCGACTGGCTTCCTGCGGCACGCAGTCTCGACGACGTGCCGACAA
CGGTCGACAGCGTGACCGTGCTTGCTGGTGTAGCACTGATGGACGCTCAGGGCGGCAACTGCGTCGAACC
CGGCGAAAAGCCTGCGCGGCCGCGGCGCGTGACCCGCGAATACAAGCACGTTGCCGATCTGAACGGCGAC
GGACAGGAAGAAATCAGTGTCGAGCGCAACGTGGTAGCCCTTCTGTTCGACTTCGAGCAGGCCGGAGACT
ACGTCACCTGTCCGATCGCGCGGCTCGTGCGCACGCCACAAGGGCGGTTCGAACAGGACAAGAGCTTCGT
CCCGCCGTGCCTGTTCCTGTCGGCGAGCGATCGCCTCGTGCATCGCGCGCAGCGCATCTCCGAAATCCTG
TCTGCCAAGAGCGCCAGCCTTGCGGTGCGCCGCAAAGAGCGCTCGGATCAGATCGCCGATTTCGCCGTGT
CCGACGTGGCGCTCTTCTGGCTGTTACATAGCGTGAATAGCACGTGGCCCGAACTCGCCCGTCTCGTACA
GGCGCCGGACCAGCATCCGGAACGGCTCTACGCCGTGCTCGCCCGCTTGGCCGGCTCACTGCTGACGTTC
TCTACGACCGAGTCGCTCCAGGCGATTCCGCTATACGATCACCACGCACCGGAGCCGATGTTTGCCGAGC
TCGAATCGCTGATCAGAACACTGCTCGACGCCGTGATTCCGTCCCGAGTCGTGCCGATTGCACTCGAGCG
CGTGCGCGCGACCACATGGCTCGGCCGAATCAACGACGAGCGGCTGACGGAAGGCGCTGAATACTATCTG
TCGGTTCAGGCCGCCATGCCCGCACACGCCCTCATCGAGCACCTGCCGCGCCTCTGCAAGGTCGGCGCAC
CGGACGAAGTCGAGCAGATCGTCAATTCCGCACTGCTCGGCATCGCACTGCGACCGATGTCGCGCCTGCC
TGCCGCGATTCCCGTGCGGATAGAAAACCAGTACTTCGCGCTGGACAGCAACGATGCCGCGTTCAAGCGG
ATGATCGACGCGCATGCCTGCCAGATCTACGTGCCGGCGTCGATTCCTGAAGCGTCGCTCGAGCTGTATG
CGGTGCTGCCGTCATGA