SecReT6
Protein ID: 134293829
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5149
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2061825..2062487 [+]
Producthypothetical protein
NoteTssL
UniProt IDA4JP97
KEGG IDbvi:Bcep1808_5149
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-36, Aligned region: 15..209
Protein Sequence: 220 a.a.     [Download]
>gi|134293829|ref|YP_001117565.1| hypothetical protein Bcep1808_5149 [Burkholderia vietnamiensis G4]
MSAVTMADSPLLPVALRDTARTVTALAEEPLSFDALRGQCNTQIDQLRSDLGLRGLPDHGINDAVYALCA
LLDEAALKHLTGEARESWEKRPLQEERFSRNDAGEELVRRIEDRLLEPRSPRVLLAIFAAVLSLGFTGRF
AMDGSTARAALIRTLDERLGRTTAAEDNHAAPASIVVNRTNARPLRISPLTWVVASCVAVGVAWFMVDRW
FIASIAQIAQ
 
Nucleotide Sequence: 663 bp     [Download]
>gi|134292031|ref|NC_009255.1|:2061825-2062487 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGAGTGCGGTGACGATGGCAGATTCGCCCCTGCTCCCGGTTGCGTTACGCGACACGGCACGCACGGTCA
CCGCACTGGCCGAAGAGCCGCTGTCGTTCGACGCGCTTCGAGGCCAATGCAACACGCAGATCGACCAACT
GCGCTCCGATCTGGGCTTGCGAGGCCTCCCGGATCACGGGATCAACGATGCGGTCTACGCGCTGTGCGCG
CTGCTCGACGAGGCCGCATTGAAGCACCTCACGGGAGAAGCTCGCGAAAGCTGGGAGAAGCGGCCGCTCC
AGGAGGAACGTTTCTCGAGAAACGATGCTGGCGAGGAATTGGTACGACGCATCGAGGATCGCTTGCTCGA
GCCACGGTCGCCGCGGGTGCTACTTGCGATATTCGCCGCGGTGCTGTCGCTTGGCTTCACCGGACGGTTT
GCGATGGACGGGAGTACAGCGCGTGCGGCGCTTATTCGCACCCTCGACGAACGACTCGGGCGCACGACCG
CAGCGGAGGACAACCACGCAGCGCCTGCTTCGATCGTGGTGAACCGCACCAACGCCCGCCCGCTGCGCAT
TTCTCCGCTGACTTGGGTGGTCGCCTCGTGCGTCGCCGTCGGCGTCGCCTGGTTCATGGTCGATCGATGG
TTCATCGCGTCGATTGCGCAGATCGCGCAATAA