SecReT6
Protein ID: 134293830
SecReT6 ID197
T6SS typeN/A
Gene symbol-
Locus tagBcep1808_5150
StrainBurkholderia vietnamiensis G4
Repliconchromosome II [GenBank: NC_009255] [Browse all T6SS(s) in this replicon]
Location [Strand]2062500..2062931 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA4JP98
KEGG IDbvi:Bcep1808_5150
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.20E-18, Aligned region: 29..114
Protein Sequence: 143 a.a.     [Download]
>gi|134293830|ref|YP_001117566.1| GPW/gp25 family protein [Burkholderia vietnamiensis G4]
MWVGPGLFERITGHFADGSGVDDFASEVQVFLSVRDNIERILNSRRGSLAHLPDYGLDDLSEIYRHLPSS
AHKLRRAIEATLLAYEPRLKRIEIEIHPPEPGMLISFTMACHLHQAGLVRFGTNFMPDGKTRLRMLQAAL
DRY
 
Nucleotide Sequence: 432 bp     [Download]
>gi|134292031|ref|NC_009255.1|:2062500-2062931 Burkholderia vietnamiensis G4 chromosome 2, complete sequence
ATGTGGGTAGGACCTGGCTTATTCGAGCGGATTACCGGGCACTTCGCTGACGGCTCTGGCGTGGACGACT
TCGCGTCAGAAGTGCAGGTTTTCCTGTCGGTGCGCGACAACATCGAGCGCATCCTGAATAGTCGGCGCGG
GTCTCTCGCGCACCTTCCGGACTACGGCCTAGACGACCTGTCGGAGATCTATCGGCATCTGCCGTCCTCG
GCGCACAAGCTGCGGCGCGCGATCGAGGCGACCCTGCTCGCTTACGAACCGCGTCTGAAGCGAATAGAAA
TCGAAATTCATCCGCCCGAGCCTGGTATGTTGATCAGCTTCACGATGGCCTGCCATTTGCATCAGGCAGG
GCTCGTGCGCTTCGGCACGAACTTCATGCCGGACGGCAAAACCAGACTGCGCATGCTGCAGGCAGCGCTC
GACCGATACTGA