SecReT6
Protein ID: 134294549
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0437
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]466678..469149 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA4JAZ6
KEGG IDbvi:Bcep1808_0437
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-54, Aligned region: 44..353
DUF2345 [PF10106], Evalue: 7.90E-50, Aligned region: 641..794
T6SS_Vgr [PF13296], Evalue: 1.50E-32, Aligned region: 402..412
T6SS_Vgr [PF13296], Evalue: 1.50E-32, Aligned region: 504..608
T6SS_Vgr [PF13296], Evalue: 1.50E-32, Aligned region: 658..679
T6SS_Vgr [PF13296], Evalue: 1.50E-32, Aligned region: 743..763
Phage_base_V [PF04717], Evalue: 7.40E-20, Aligned region: 69..92
Phage_base_V [PF04717], Evalue: 7.40E-20, Aligned region: 392..479
Protein Sequence: 823 a.a.     [Download]
>gi|134294549|ref|YP_001118284.1| Rhs element Vgr protein [Burkholderia vietnamiensis G4]
MQNTAQALRELALGPQHNRQVQIAFPDDNAPYKILLPNAFEAVEALSKDFAYKIEILSDNDHLAPKDFIG
KRVTVSLLRGDGSQRYFNGHIFAFRHVRTDGGWVFYEAHVGPWLRYLKYGKHNRLFLDQNLHDQTATVFQ
DYGVLPEWAWRVGEADPRMTMACQFDEDDHNYVHRRWEHAGYLYWYEHTATSHKLTVSDPTRPAPAIDGR
GHEIRFHNGMGAEESDSVLSWSPFQQTTSTHAELSRFDFKSPTPTHVQTSLLNPEAALPQLEWNEYAGAY
GYRNMEHGYQVANRRMEEIEATIKRFDAKGNNRFVQPGRWFRLTDRYGSALSRDQSDDEYLIIAVRHVAT
NNYLQDTGVLAEYRNEFTCVPRATAWRPGRGFNSVDTKILAPQTAIVVGQSGTSIHTDEHGRVLVQFHWD
RDGKYSTWVRVASGWAGGGQGMAALPRIGSEVIVQWLDGNPDHPIITGRVMNARNVPSWKLPDENALMGI
RSRELNGADGNASSGRSNHLIFDDTANAIQVQLRSDHAASQLSLGKIKRIEDWQGRKDARGEGFELRTDE
VGAIRTGKGMVISTEVRPAAQGHLSDIGEPASRLTKAQTLHGQLGKLAQHYQAQDNGGDQTPIADALKSQ
VDGIQGAGATGSSDKGEFPELNEAHLLLAGAAGIAVTTPATAHVTGGQHVAVTAGESMSVATGKSFFASV
SDKFSLFVHKMGMKLIAASGKVQVHAENDELELLAKKVLSIISTTDWINITAKQGIRLTAGNSQLEVSAK
GIVGYTPGENKIHAGSHDTVGPQSMPAQFPGSDLCSQLADGAAQTGQASIALA
 
Nucleotide Sequence: 2472 bp     [Download]
>gi|134294128|ref|NC_009256.1|:466678-469149 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGCAGAATACGGCACAAGCCCTGAGAGAACTTGCGCTAGGGCCGCAGCACAACCGGCAGGTGCAGATAG
CCTTTCCGGACGATAACGCGCCCTACAAAATCCTACTGCCGAACGCATTCGAGGCGGTCGAAGCGCTATC
GAAGGATTTCGCGTACAAGATCGAAATCCTGTCGGACAACGACCACCTTGCGCCAAAGGATTTCATCGGC
AAGCGCGTGACGGTCAGTCTGTTGCGTGGCGACGGCAGTCAGCGGTATTTCAACGGCCACATCTTCGCAT
TCCGGCATGTTCGCACGGACGGCGGCTGGGTGTTCTACGAGGCGCACGTCGGTCCTTGGCTACGCTATCT
GAAGTATGGCAAGCACAATCGTTTGTTCCTCGATCAGAACCTGCACGACCAGACGGCGACAGTTTTTCAG
GACTACGGCGTGTTGCCAGAATGGGCGTGGCGGGTCGGCGAAGCCGATCCGCGCATGACGATGGCCTGCC
AGTTCGACGAAGACGACCACAATTACGTTCATCGACGCTGGGAACACGCTGGTTATTTGTACTGGTACGA
GCACACGGCCACGTCGCACAAGCTGACCGTCTCTGATCCGACGCGTCCCGCGCCAGCGATCGACGGCAGG
GGGCACGAAATCCGCTTCCACAATGGCATGGGCGCGGAGGAATCGGACAGCGTTCTGAGCTGGTCCCCGT
TCCAGCAGACCACTTCGACGCATGCGGAACTGTCACGTTTCGACTTCAAGAGCCCGACGCCGACCCACGT
TCAAACGAGTCTGTTGAACCCCGAAGCCGCGCTGCCGCAGCTTGAATGGAACGAGTACGCCGGTGCGTAC
GGCTATCGGAACATGGAGCACGGCTATCAGGTCGCAAACCGCCGGATGGAGGAAATCGAAGCGACGATCA
AGCGCTTCGACGCGAAGGGCAACAATCGCTTCGTGCAGCCGGGCCGCTGGTTCCGGCTGACGGACCGTTA
TGGCTCGGCGCTGAGCCGCGATCAGAGCGACGACGAATACCTGATCATCGCGGTTCGGCATGTGGCGACC
AACAACTATTTGCAGGACACAGGGGTACTGGCGGAATACCGCAATGAGTTCACGTGCGTACCCAGGGCAA
CCGCCTGGCGGCCCGGGCGCGGCTTCAACAGCGTCGACACGAAGATTCTCGCGCCGCAGACGGCGATCGT
CGTCGGCCAGTCCGGCACAAGCATTCACACCGACGAACACGGCCGCGTGCTGGTTCAGTTCCATTGGGAT
CGCGACGGCAAGTATTCGACGTGGGTGCGGGTCGCAAGCGGCTGGGCTGGCGGCGGCCAGGGGATGGCGG
CACTGCCGCGGATCGGTTCGGAAGTCATCGTGCAATGGCTCGACGGCAATCCGGACCACCCGATCATTAC
GGGCCGCGTGATGAACGCGCGCAACGTCCCGTCGTGGAAGCTGCCGGACGAGAATGCGCTAATGGGCATT
CGCAGCCGGGAGCTGAACGGTGCGGACGGCAACGCGTCGTCAGGTCGCAGCAATCATCTAATTTTCGACG
ATACGGCGAACGCGATTCAGGTGCAACTTCGATCCGACCATGCGGCAAGCCAGCTCTCGCTCGGCAAGAT
CAAGCGAATCGAGGATTGGCAGGGGCGCAAGGATGCCCGTGGCGAGGGCTTCGAGCTGCGTACGGATGAG
GTCGGCGCGATCCGCACCGGCAAGGGCATGGTGATCAGCACGGAGGTGCGTCCCGCCGCGCAGGGGCATC
TCTCGGATATCGGAGAGCCGGCATCACGCCTGACTAAAGCGCAAACGTTACACGGGCAACTTGGCAAGCT
CGCGCAGCACTATCAGGCACAGGACAACGGAGGGGACCAGACGCCGATTGCCGACGCGCTGAAATCGCAG
GTGGATGGTATCCAGGGCGCGGGTGCGACGGGCAGCAGTGACAAGGGCGAATTCCCTGAACTCAATGAAG
CGCATCTGCTGTTGGCCGGCGCGGCCGGCATCGCGGTCACGACGCCTGCGACGGCGCACGTCACGGGCGG
GCAGCACGTAGCGGTCACGGCCGGCGAAAGCATGTCGGTCGCGACAGGCAAATCGTTCTTCGCGAGCGTA
TCGGACAAGTTCTCACTGTTCGTGCACAAGATGGGCATGAAGCTTATCGCGGCGAGCGGCAAGGTGCAGG
TGCATGCAGAAAACGACGAGCTGGAACTGCTGGCGAAGAAGGTCCTGTCGATCATTAGCACGACGGACTG
GATCAACATCACGGCCAAGCAGGGTATCCGCTTGACGGCCGGCAACAGCCAGCTCGAAGTCAGCGCAAAA
GGCATCGTCGGTTACACGCCTGGTGAAAACAAGATTCATGCGGGCAGCCACGATACGGTGGGCCCGCAGA
GCATGCCGGCGCAGTTCCCTGGATCGGACTTGTGCTCGCAATTGGCTGACGGTGCCGCACAAACCGGTCA
AGCGTCGATCGCGCTCGCCTGA