SecReT6
Protein ID: 134294555
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0443
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]475607..475831 [+]
Producthypothetical protein
NoteTssF
UniProt IDA4JB02
KEGG IDbvi:Bcep1808_0443
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.40E-10, Aligned region: 4..59
Protein Sequence: 74 a.a.     [Download]
>gi|134294555|ref|YP_001118290.1| hypothetical protein Bcep1808_0443 [Burkholderia vietnamiensis G4]
MDHLLSRYEYGLGLFVRALGDFAIRYPKTAAWLGIQSGRTDDPQVTRQIQTFSSLAARFVRSGSKTTPNS
PRRC
 
Nucleotide Sequence: 225 bp     [Download]
>gi|134294128|ref|NC_009256.1|:475607-475831 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGGATCACCTGTTGTCGCGTTACGAATACGGACTCGGGTTGTTCGTGCGTGCACTGGGCGATTTCGCTA
TCCGATACCCAAAGACCGCCGCCTGGCTCGGCATCCAGAGCGGGCGGACTGACGATCCGCAAGTGACGCG
TCAGATTCAGACCTTTTCGTCTCTTGCAGCGCGCTTCGTCCGAAGCGGGTCGAAGACTACCCCGAATTCA
CCAAGGCGCTGCTAG