SecReT6
Protein ID: 134294563
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0451
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]481212..484385 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA4JB10
KEGG IDbvi:Bcep1808_0451
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-73, Aligned region: 39..351
Phage_GPD [PF05954], Evalue: 6.70E-73, Aligned region: 581..653
Phage_GPD [PF05954], Evalue: 6.70E-73, Aligned region: 823..925
DUF2345 [PF10106], Evalue: 2.90E-59, Aligned region: 666..818
DUF2345 [PF10106], Evalue: 2.90E-59, Aligned region: 931..1007
T6SS_Vgr [PF13296], Evalue: 7.80E-37, Aligned region: 522..628
T6SS_Vgr [PF13296], Evalue: 7.80E-37, Aligned region: 949..996
Phage_base_V [PF04717], Evalue: 5.40E-21, Aligned region: 422..512
Phage_base_V [PF04717], Evalue: 5.40E-21, Aligned region: 873..890
Sarcoglycan_1 [PF04790], Evalue: 0.0028, Aligned region: 711..783
Protein Sequence: 1057 a.a.     [Download]
>gi|134294563|ref|YP_001118298.1| Rhs element Vgr protein [Burkholderia vietnamiensis G4]
MQNTVAALRGGLLQQDRLLKLDTPLGANVLTVQRAVGRARIGRAYEFTLDVLSTDSDVELKKLIAQPVTL
WIQQADRSYRPVNGYVHTARRLGADGGLTTYQLTFADFTHFLKFRRDQRIWNDTTVDQIISDVLNQHPQA
RGHFRFALSQPLPSRSYTRQHDTDWHFVHRLMESEGLYTTWQQADDGKSHTLVITDNLQAFAPLSPQTVR
FYRGGAASDADAFTQWSGTRTLQSVTRTTRTFDYKNPSQPSNPKGTTLPTMADQGELPDQLEVYEYTGAY
TYLDQTRGDHLTKIRMEEWESQAKRFHGAGGVRAIDAGRRFTLSDHPEHDRDPADQREFATIGVDWWIEN
NLPVASSSADFPYSLREALTQAQEGYGADPAFRVPHDDGSVGFYLVEVEAQRVSVPYRSPFEHEKPKMHL
ETAIVVGPQGEEVYTDELNRIRVQFVWDRLNPGNENASCWVRVVQSDTGGGYGGVHVPRIGEEVLIDYVG
GDCDRPLAVGRVYNGANQPQWHSDGILSGYRSKEYSGSGYNQLVMDDATGQNRVQLMSSSANSLLHLGYI
IDQNGNTRGSYLGSGFDLRSDAYGAVRASRGLYVTTHPKAANSQPLDVTEAQQQLVSGESLIEALSGVSE
QHQAESLKDAQEAMRAFTDATQDRASGNASGGRTAGGGTGSANAFKEPVMLFGSPSGIAMSTQESLHMVA
NDHVNVASGQSVHVAAGKSLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQSDNVEVTAQKAVKVVSATD
RIEIAADQGILLTSGGAYIRVKDGNVEIHAPGKIDVKGASHTFAGPASLGYPLPSARPDQPGQLELFHKY
MNGEAVKGGLFTVKDVNGTVLKKGALDNSGYTVVSGLPPGAVRVEFGKDPRASDQPANYFKQAKWPAEPV
APSPEAAQAAASGQLASQLQGMAPAASTAAMGFASGSGAGAALGGLAGAALPAAAAAVGGAGVASAVQTA
SSLSGAAKQVAAMVQTARQGGLAALAAPAANAASGALQSALPGVAGVAGKAATTTATASAAGGMKLPTSG
FGGPLKS
 
Nucleotide Sequence: 3174 bp     [Download]
>gi|134294128|ref|NC_009256.1|:481212-484385 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGCAGAACACTGTTGCCGCATTGCGCGGCGGGTTGCTTCAGCAGGACCGGCTGTTGAAGCTCGATACGC
CACTGGGTGCCAACGTGCTGACCGTGCAACGAGCGGTCGGCCGTGCGCGCATCGGCCGGGCCTATGAATT
CACGCTCGACGTGCTGTCGACCGACAGCGACGTGGAGCTGAAAAAGCTGATCGCGCAACCGGTCACGCTA
TGGATTCAGCAAGCCGACCGCAGCTACCGGCCCGTCAACGGCTACGTGCACACGGCGCGGCGCCTGGGCG
CCGACGGCGGGCTCACCACCTACCAGCTGACGTTCGCCGATTTCACCCATTTCCTGAAGTTCCGTCGCGA
TCAGCGCATCTGGAACGACACGACCGTCGACCAGATCATCAGCGACGTGCTGAACCAGCATCCGCAGGCG
CGCGGGCATTTCCGCTTCGCGCTGTCGCAGCCGCTGCCAAGCCGCTCGTACACGCGCCAGCACGACACCG
ACTGGCATTTCGTGCATCGGCTGATGGAGAGCGAAGGCCTTTACACCACATGGCAGCAGGCCGACGACGG
CAAGTCGCACACGCTCGTCATCACCGACAACCTGCAGGCGTTCGCGCCGCTGTCGCCGCAAACCGTGCGC
TTCTATCGCGGCGGGGCAGCGAGCGATGCCGACGCGTTCACGCAATGGTCGGGCACGCGCACGCTGCAGA
GCGTCACGCGCACGACACGCACGTTCGACTACAAGAACCCTTCCCAGCCGTCGAATCCGAAGGGCACGAC
GCTGCCGACGATGGCCGATCAGGGCGAATTGCCCGACCAGCTCGAAGTCTACGAGTACACCGGTGCGTAC
ACGTACCTCGACCAGACCCGCGGCGACCATCTGACGAAGATCCGGATGGAGGAATGGGAGTCGCAGGCGA
AGCGCTTCCACGGCGCGGGCGGCGTGCGTGCGATCGATGCGGGTCGGCGCTTCACGCTGTCGGATCATCC
CGAACACGATCGCGATCCGGCCGACCAGCGCGAGTTCGCGACGATCGGCGTCGACTGGTGGATCGAGAAC
AACCTGCCGGTCGCGAGCAGCAGCGCGGACTTTCCGTACAGTCTGCGCGAAGCGTTGACGCAAGCTCAGG
AAGGCTACGGGGCCGATCCGGCATTTCGCGTGCCGCACGACGACGGCTCGGTAGGCTTCTATCTCGTCGA
AGTCGAAGCGCAGCGGGTGAGCGTGCCGTATCGCAGCCCGTTCGAGCACGAGAAGCCGAAGATGCATCTG
GAGACGGCGATCGTCGTCGGCCCGCAGGGCGAGGAAGTCTATACGGACGAGTTGAACCGGATCCGCGTGC
AGTTCGTGTGGGATCGCCTCAATCCGGGCAACGAGAACGCGTCGTGCTGGGTGCGCGTCGTGCAGTCCGA
TACCGGTGGCGGCTACGGCGGCGTGCACGTGCCGCGCATCGGCGAGGAAGTGCTGATCGACTACGTCGGC
GGCGACTGCGACCGGCCGCTGGCGGTCGGGCGCGTGTACAACGGCGCGAACCAGCCGCAGTGGCATAGCG
ACGGCATTCTCTCCGGATACCGCTCGAAGGAATATTCGGGCAGCGGCTACAACCAGCTCGTGATGGACGA
TGCGACCGGGCAGAACCGCGTGCAACTGATGAGCAGCAGCGCGAACAGCCTGCTGCATCTCGGCTACATC
ATCGACCAGAACGGCAACACGCGCGGGTCGTATCTGGGCAGCGGCTTCGATCTGCGCTCGGACGCATACG
GCGCGGTGCGGGCGAGCCGCGGCCTGTACGTGACGACCCATCCGAAGGCAGCGAACAGCCAGCCGCTCGA
CGTGACGGAAGCGCAGCAGCAGCTCGTGTCCGGGGAGAGCCTGATCGAGGCGCTGTCGGGCGTGAGCGAG
CAGCATCAGGCCGAAAGCCTGAAGGACGCGCAGGAGGCGATGCGTGCGTTCACCGACGCGACGCAAGACC
GTGCATCGGGCAACGCATCGGGCGGCCGCACGGCGGGCGGCGGCACGGGGAGCGCGAACGCGTTCAAGGA
GCCGGTGATGCTGTTCGGCAGCCCGTCGGGGATCGCGATGTCGACGCAGGAGTCGCTGCACATGGTCGCG
AACGATCACGTGAACGTCGCGAGCGGCCAGAGCGTGCATGTCGCGGCGGGCAAATCGCTGATCGGCAGCA
TCGGCCAGAAGCTGAGCCTGTTCGTGCAGAACGCGGGGATGAAGCTGTTCGCGGGCAAGGGCAAGGTGGA
GATCCAGGCGCAGTCGGACAACGTCGAGGTGACCGCGCAGAAGGCGGTGAAGGTTGTATCCGCAACCGAC
CGGATCGAGATCGCGGCCGATCAGGGGATTCTGCTGACGAGCGGCGGGGCGTACATCCGAGTCAAGGATG
GCAACGTCGAAATCCACGCACCGGGCAAGATCGATGTGAAGGGTGCGTCGCATACGTTCGCCGGGCCGGC
GAGCCTGGGCTATCCGTTGCCGAGCGCGCGGCCCGATCAGCCGGGCCAGCTGGAGCTGTTCCACAAGTAC
ATGAACGGCGAGGCCGTGAAGGGCGGGCTCTTCACGGTGAAGGACGTGAATGGCACGGTGCTGAAGAAGG
GCGCGCTCGACAACAGCGGCTATACCGTCGTCAGCGGCTTGCCGCCGGGCGCGGTGCGCGTCGAGTTCGG
CAAGGATCCGCGCGCGTCGGACCAGCCGGCGAATTACTTCAAGCAGGCGAAGTGGCCGGCCGAGCCGGTG
GCGCCTTCGCCGGAAGCCGCGCAGGCGGCGGCGAGCGGACAGCTTGCGAGCCAGTTGCAAGGCATGGCGC
CGGCGGCATCCACGGCGGCGATGGGGTTCGCGAGCGGCAGCGGCGCCGGCGCCGCACTTGGCGGGCTCGC
GGGCGCCGCGTTGCCGGCCGCGGCGGCTGCGGTCGGCGGAGCGGGCGTCGCGTCGGCCGTGCAGACGGCC
TCCAGCCTTAGTGGCGCGGCAAAGCAGGTGGCTGCAATGGTGCAGACCGCGCGCCAGGGCGGCCTGGCTG
CGCTCGCCGCGCCTGCCGCAAATGCTGCGTCGGGCGCGCTCCAGAGCGCGTTGCCCGGTGTCGCCGGAGT
CGCGGGCAAGGCCGCAACGACGACTGCGACGGCGTCGGCAGCGGGCGGCATGAAGCTGCCGACGAGCGGC
TTCGGCGGACCGTTGAAATCCTGA