SecReT6
Protein ID: 134294568
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0456
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]491636..492418 [-]
Producthypothetical protein
NoteTssL
UniProt IDA4JB15
KEGG IDbvi:Bcep1808_0456
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.90E-58, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|134294568|ref|YP_001118303.1| hypothetical protein Bcep1808_0456 [Burkholderia vietnamiensis G4]
MSYAPSLFGDNAPAPLHTPASTDAAFQARSLLDLLYDGFFMLFLLKNGRAPDSASEFSTKIQEFLSDFER
GAKKLNIAAEDVYAAKFAYCAAVDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAAFAPHWPLPDQIAHRLKREVPVW
AIGAVFALVALLGYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|134294128|ref|NC_009256.1|:c492418-491636 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGCGCCGGCCCCGTTGCATACCCCGGCGTCGACCGACG
CCGCGTTCCAGGCCCGCTCGCTGCTCGACCTGCTGTACGACGGGTTCTTCATGCTGTTCCTGCTCAAGAA
CGGCCGCGCGCCGGACAGCGCGAGCGAGTTCAGCACGAAGATTCAGGAATTCCTGTCGGACTTCGAACGC
GGCGCGAAGAAGCTGAATATCGCGGCGGAGGACGTGTATGCGGCGAAGTTCGCGTATTGCGCGGCCGTCG
ACGAGATGGTGCTGTCGTCGCAGTTCAAGATCCGGGCCGACTGGGAACGCCGGCCGCTGCAGCTGGTGCT
GTTCGGCGAGCAGCTCGCGGGCGAGAAGTTCTTCCAGTATCTGGAGGAATGCCGGGCGCAAGGTGCGGCG
CGGCTGCAGTCGCTCGAGGTGTTCCACATGTGCCTGCTGCTCGGGTTCCAGGGCAAGTATCTGCTCGAGG
GGCCGGAGAAGCTCGCTTATCTCACCGCGCGGCTCGGCGACGAGATCGCGCATATGAAGGGCAAGCGCGC
TGCGTTTGCGCCGCATTGGCCGCTGCCGGATCAGATTGCGCACCGGTTGAAGCGCGAGGTACCGGTGTGG
GCGATCGGCGCGGTGTTCGCGCTTGTGGCGCTGCTCGGCTATCTCGGGCTGAACACCTATCTGAAGGACA
AGACGCTGCAGGCGCTGGCGCCTTATTCGCAGGTGATCAAGGTCGGGCCGGAGTCGGCGAATCTGACGAT
TTCGCTGCCTTGA