SecReT6
Protein ID: 134294569
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0457
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]492415..493761 [-]
Producthypothetical protein
NoteTssK
UniProt IDA4JB16
KEGG IDbvi:Bcep1808_0457
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-136, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|134294569|ref|YP_001118304.1| hypothetical protein Bcep1808_0457 [Burkholderia vietnamiensis G4]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGLRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPASGFTTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFELDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPNVELIDAVPARFKVGAPDDVDKLVLSAMPGVRLSYMPQVPPAIPVRPGACYFQLDSRGALYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|134294128|ref|NC_009256.1|:c493761-492415 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAACGGCAGG
ACGCCTATCACGAGGCGCGCCTGTTCGAATCGATCCAGGCGATTCAGCCGTACAACTGGGGCTTGCGCTC
GGTGCGCATCGATCGCGATGCGCTCGGCAGCAACGTGCTGCGCGTGGCCGAGCTCGCGCTCGTGTTCCCG
GACGGCGCACTGTATGCCGCGCCGCAGGCCGACGACCTGCCGCCGCCGATCGCGCTCGACACGCTGCCCG
ACGGCATCAACGAATTCGTGTTCTACCTCGCGCTGCATCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCGTCCGGCTTCACGACGCGTTTCGTCAGCGAGCAGACGAGCGTCGCCGACAACTTCACCGAC
GCGGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGTTGCTGTCGGTGCCGCTCGTGCGTGTGCGGCGCACGGCGACGTCCGGCTTCGAGCTCGACGACAGCTT
CGTGCCGCCGTGTCTCGCGATCGAAGCGTCGCCGATCCTGCACCAGCGGCTGCGCCAGCTGGTCGACGCG
CTGCAGGCGAAGGTCAATGCGCTGTACGGCTTTCACCGCGAGCCGTCGAAGAACATCATCGAGTTCCGTT
CGGGCGACATCGCGTCGTTCTGGCTGCTGCACACCGCGAACGCTGCGTTCGCGACGCTCGCGCATCTGCA
TCAGCATGCGGCGCTGCATCCGGAGCGGCTGTTCCAGGAGCTGCTGCGCCTCGCGGGCCAGCTGATGACG
TTCTCGAAGGGCTACACGCTCGCCGACCTGCCCGTGTATCGCCACGACGATCCGGGCCCGAGCTTCGCGC
GTCTCGACCTGATGCTGCGCGAGCTGCTCGACACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
CGAAGTGCGTCCGTCGTTCCACCTCGGCCGCCTCGATTCGGGCAAGATCGACGACAAGACCGAGTTCTAT
CTGGCCGTGTCCGCCGACATGCCGAACGTCGAACTCATCGACGCGGTGCCGGCCCGCTTCAAGGTCGGTG
CGCCGGACGACGTCGACAAGCTCGTGCTGTCGGCGATGCCCGGCGTGCGGCTGTCGTACATGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGGCCCGGTGCGTGTTACTTCCAGCTCGACTCGCGCGGCGCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCGGCGATGATCTATGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA