SecReT6
Protein ID: 134294570
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0458
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]493864..494475 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA4JB17
KEGG IDbvi:Bcep1808_0458
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-36, Aligned region: 16..175
LPAM_1 [PF08139], Evalue: 0.0063, Aligned region: 6..23
Protein Sequence: 203 a.a.     [Download]
>gi|134294570|ref|YP_001118305.1| hypothetical protein Bcep1808_0458 [Burkholderia vietnamiensis G4]
MKSTMIRYALPLLASALLAGCAAAPLLGSAASAVMQAAGIGKPELPDSQKPPRNIGLTLAAASNLNAAND
RKPLALVVRLYSLKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGI
VALFRDPAIQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDGTVIAPQQGAPSQPLNLLSSVTCG
 
Nucleotide Sequence: 612 bp     [Download]
>gi|134294128|ref|NC_009256.1|:c494475-493864 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGAAATCGACCATGATTCGCTATGCGCTGCCGCTGCTCGCGAGCGCGCTGCTGGCCGGATGTGCGGCCG
CCCCGTTGCTCGGCTCGGCCGCGAGCGCCGTGATGCAGGCCGCCGGCATCGGCAAGCCCGAGCTCCCGGA
TTCGCAGAAGCCGCCGCGCAACATCGGGCTTACGCTCGCGGCGGCGTCGAACCTGAACGCCGCGAACGAT
CGCAAGCCGCTCGCATTGGTGGTGAGACTCTACTCGCTGAAGGACCCGACTTCGTTCCAGCAGGCGCCGT
TCGACGCGTTCACCGATCCGACCAAGGAAAAGGCCGCGCTCGGCGCCGATCTGCTGAACGTGCGCGAGAT
CACGCTGATTCCGGGCCAGCGCTATACGGCGACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGCATC
GTCGCACTGTTCCGCGATCCGGCCATCCAGCGCTGGAAACTGACGTTCGACCCGGCAAAGTCGGAGAAAT
CCGGCATAATCATCGGCCTGCATAATTGCGCGATGACGGTCACCGATGGCACCGTGATCGCACCGCAACA
GGGTGCGCCTTCGCAACCGCTGAATTTGCTTTCGTCGGTCACCTGCGGATAA