SecReT6
Protein ID: 134294572
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0460
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]495540..496055 [+]
Producthypothetical protein
NoteTssB
UniProt IDA4JB19
KEGG IDbvi:Bcep1808_0460
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.10E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|134294572|ref|YP_001118307.1| hypothetical protein Bcep1808_0460 [Burkholderia vietnamiensis G4]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSADGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLTNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|134294128|ref|NC_009256.1|:495540-496055 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGGCCAAGAAAGAGAGCATTCAGAAAAGTCTGCAGAAGATACGGCCGCCGCGTGTCCAGCTGACCTACG
AGGTCGAGAAGGGCGACGCGATCGAGGTGAAGGAATTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGCCAGTCGGAAGTCGAGCAGCCGAAGCTGCGCGACCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCCGCGTTTCAGGTGGAGAACCGCCTGAGCGCGGACGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCCAAGCTCGCCGATCTGCGCAACAAGCTTGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCCGAGGTGCTGACGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CCGGCGGCGACAAAGACGGCGAATGA