SecReT6
Protein ID: 134294573
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0461
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]496071..497561 [+]
Producthypothetical protein
NoteTssC
UniProt IDA4JB20
KEGG IDbvi:Bcep1808_0461
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|134294573|ref|YP_001118308.1| hypothetical protein Bcep1808_0461 [Burkholderia vietnamiensis G4]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGLDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTEHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|134294128|ref|NC_009256.1|:496071-497561 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCGCTGCTCGACG
ACATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGCGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGCACGGTGATCGTGTCCGACAACCTGTCGGCGACGATCGACGCGCGG
GTCGCCGAGCTCGACCGCCTGATCTCCACGCAGCTGTCCGCGGTGATGCATGCGCCGGAGTTCCAGCGCC
TCGAAAGCACGTGGCGCGGCCTCGACTATCTGGTCAAGGAAAGCAACACCGGCCAGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGACCTCGTGCGCGACTTCAAGGGCGCGAGTGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGCGCGCTGATCGGCG
ATTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCACGTTGCGGCCGCCGC
GCACGCGCCGTTCATCGCATCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCGCCGATCTCGGCAAG
CCGCGCGACCTCGGCAAGGTGTTCGACACGGTCGAATACGCGAAGTGGAAGTCGTTCCGCGATGCCGAAG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCCTCGGTCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCAGAGAACTTCAACTTCGTCGAGGACGTCGACGGCACCGAGCACGACAAATACCTGTGGTGCAAC
GCGGCGTGGGCCTTCGCGGCACGCCTGACGGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAAGGCGGCGGCCTCGTGGAGGACTTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTGCATTGCAAAAACTCGGATTACGCTGCGTTCTTCGCCGCGCAATCGGTGCAGAAGCCGAAAA
AGTACAGCACCGACAGCGCGAATGCGAACGCCGTCCTGTCTGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTG
GAGACTTTCCTCAACCGGTGGATTTCGCAATACGTTCTGCTCGACGACAACGCATCGCAGGAGCAGAAAG
CGCAATTTCCGCTGCGCGAGGCATCCATACAAGTATCGGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA