SecReT6
Protein ID: 134294575
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0463
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]498198..498683 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA4JB22
KEGG IDbvi:Bcep1808_0463
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|134294575|ref|YP_001118310.1| GPW/gp25 family protein [Burkholderia vietnamiensis G4]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTELELAALPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQSTNALYFAIQALLVVHPAEEPVNFD
AMLQPSTLQYSVTRARAARMQ
 
Nucleotide Sequence: 486 bp     [Download]
>gi|134294128|ref|NC_009256.1|:498198-498683 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGAAACGCTTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCACCTGCCGGCCTCGGCAG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTCGCCCGCGACGTCGAGGCGATCCTCAACAC
CCGTATCGCGCACACCGAACTCGAGCTGGCGGCGCTGCCGGAATGCCAGAAATCGGTGCTTACCTACGGG
CTGAACGACTTCGCGGGCCTGAGCCTCGCGAGTCACTATGACCGCGCGTTCATCTGCAAGTCGATCCAGC
AGGCCATCGCACGCCACGAGCCGCGGTTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGTCGAC
CAACGCGCTGTACTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCGGCCGAGGAGCCGGTGAATTTCGAC
GCGATGCTGCAGCCGTCGACGCTGCAGTATTCGGTCACGCGCGCACGCGCGGCCAGAATGCAGTGA