SecReT6
Protein ID: 134294576
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0464
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]498761..500596 [+]
Producthypothetical protein
NoteTssF
UniProt IDA4JB23
KEGG IDbvi:Bcep1808_0464
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.30E-215, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|134294576|ref|YP_001118311.1| hypothetical protein Bcep1808_0464 [Burkholderia vietnamiensis G4]
MEELLPYYERELSFLRRYSQDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIQRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARFTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLPSLRAHLHGEQSFVAALTDCLFVNVLAA
YVEPERNGRWTAFRNLPIAQAGFDEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDVAAIARAAGRC
QRATLHLVLQDVRSDSHVARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQEGGAQTSGISMLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|134294128|ref|NC_009256.1|:498761-500596 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAATTATCGTTTTTGCGGCGCTATTCGCAAGATTTCGCGG
AACGCTATCCGAAGATCGCGGCGCGGCTCGCGTTGTCGGGCGAGCATTGCGAGGATCCCCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTCGGCGCGCGCATCAACAAGAAGCTCGACGACGACTACCCCGAGTTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAGT
TCACGCCGGCCTCGCCCGGCCAGCAGACCGAACCGGTCGTGATTCAGCGCGGCACCGAGCTGAAGAGCCG
CCCGATTCGCGGCGTGCAATGCCGGTTCCGCACCGCCTACGACGTGACGCTCGCGCCGATCCGCATCTCC
GAGGCACGCTTCACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCCAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGACCTCGGCGCGCTGAAGCTGCCGTCGCTGCGCGC
GCACTTGCACGGCGAGCAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCAACGTGCTGGCCGCG
TACGTCGAGCCGGAGCGCAATGGCCGCTGGACCGCGTTTCGCAACCTGCCGATCGCGCAGGCCGGCTTCG
ACGAAGACGACGCGCTGATCGATTACCCGGCGAAGTCGCATCCCGCCTATCGGCTGCTGACCGAATACTT
CGCGTTTCCCGACAAGTTCGACTTCGTCGATTTCGACGTCGCGGCGATCGCGCGCGCGGCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTCGTGCTGCAGGACGTGCGCAGCGATTCGCATGTCGCGCGCCTGCTCGAGC
TGCTGACGGCCAGCCATTTCCGGCTGTTCTGCACGCCGATCGTCAACCTGTTCCGCCAGCACGGCGAGCC
GATCCGCATCACGCACCGCGCGGTGTCGTATCCGGTGATCGCCGAGGCGCGGCGCGCGTTCGCGTACGAG
GTGTACTCGATCGATTCGGTGAAGCTCGTCAGGCAGCAGGCGCATGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTACTCGCTGCATCACGGCGAATCGGCGCGGATCGGCCACTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAAAAGAGCCCGGGCTACGAAACGGAGATCTCGATCGTCGACATCGACTTCGAGCCGACGTCG
CCGCAAACCGACACGCTGAGCCTCGACCTCACCTGCACCAACCGCGACCTGCCGGCGATGCTCGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGAAGGCGGCGCGCAGACGAGCGGCATCTCGATGCTGCGGCGTCC
GACGCAGAGCGTGCGCTTCGAGCGCGGCCGCGCCGCGCACTGGCGGCTCGTGTCGCACCTCGCGCTGAAC
CACGTGTCGCTGGTCGCGCACGGGCTCGCGCCGCTCAAGGAAATGCTGACCTTGTACGACCTGCGGCGCA
CCGCGGTGTCGATGCGCCAGATCGACGGCCTCGCCGGCGTCGAGCAGCGCGGCGCCGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCCACCTTCGTGCGCGGCATCGAGATTCGCCTGACCATCGACGAGGAGCATTTCGTC
GGCGCGAGCCTCGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTACGTGCACCTCAACAGTT
TCGTTCAACTAGTCGTGGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGAACCGGCGA
ATCGATCCTGGCGTAG