SecReT6
Protein ID: 134294578
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0466
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]501699..504371 [+]
ProductATPase
NoteTssH
UniProt IDA4JB25
KEGG IDbvi:Bcep1808_0466
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-44, Aligned region: 232..329
AAA_2 [PF07724], Evalue: 2.40E-44, Aligned region: 620..788
AAA [PF00004], Evalue: 3.10E-19, Aligned region: 129..148
AAA [PF00004], Evalue: 3.10E-19, Aligned region: 233..346
AAA [PF00004], Evalue: 3.10E-19, Aligned region: 625..742
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 307..363
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 624..743
ClpB_D2-small [PF10431], Evalue: 6.50E-12, Aligned region: 795..868
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 36..77
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 210..257
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 277..311
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 470..538
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 600..660
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 690..713
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 790..830
Clp_N [PF02861], Evalue: 3.30E-09, Aligned region: 23..74
Clp_N [PF02861], Evalue: 3.30E-09, Aligned region: 113..133
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 233..319
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 621..644
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 686..718
Sigma54_activat [PF00158], Evalue: 2.70E-06, Aligned region: 215..249
Sigma54_activat [PF00158], Evalue: 2.70E-06, Aligned region: 622..742
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 234..300
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 624..660
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 217..254
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 624..642
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 799..835
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 212..247
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 285..340
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 622..661
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 695..719
AAA_25 [PF13481], Evalue: 0.00039, Aligned region: 31..72
AAA_25 [PF13481], Evalue: 0.00039, Aligned region: 233..256
AAA_25 [PF13481], Evalue: 0.00039, Aligned region: 289..328
AAA_25 [PF13481], Evalue: 0.00039, Aligned region: 620..642
AAA_19 [PF13245], Evalue: 0.00055, Aligned region: 231..259
AAA_19 [PF13245], Evalue: 0.00055, Aligned region: 621..646
AAA_29 [PF13555], Evalue: 0.0006, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.0006, Aligned region: 620..649
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 233..254
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 623..656
Zeta_toxin [PF06414], Evalue: 0.0015, Aligned region: 232..253
Zeta_toxin [PF06414], Evalue: 0.0015, Aligned region: 615..664
NACHT [PF05729], Evalue: 0.0018, Aligned region: 233..260
NACHT [PF05729], Evalue: 0.0018, Aligned region: 382..461
NACHT [PF05729], Evalue: 0.0018, Aligned region: 625..645
AAA_30 [PF13604], Evalue: 0.002, Aligned region: 218..310
AAA_30 [PF13604], Evalue: 0.002, Aligned region: 620..648
MobB [PF03205], Evalue: 0.0024, Aligned region: 234..257
MobB [PF03205], Evalue: 0.0024, Aligned region: 623..656
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 625..646
AAA_18 [PF13238], Evalue: 0.0092, Aligned region: 235..253
AAA_18 [PF13238], Evalue: 0.0092, Aligned region: 626..651
ResIII [PF04851], Evalue: 0.0096, Aligned region: 220..253
ResIII [PF04851], Evalue: 0.0096, Aligned region: 297..315
ResIII [PF04851], Evalue: 0.0096, Aligned region: 596..645
Protein Sequence: 890 a.a.     [Download]
>gi|134294578|ref|YP_001118313.1| ATPase [Burkholderia vietnamiensis G4]
MSTPLKTLITKLNPLCRHAAERAASACLARGHYEVDLEHLFIALLDEATGDLPLALRASRVDPHALRADL
ERELTRLKTGNTRTPVFSVHLIALFEQAWLIASLDSQLGRIRSGHLLLALLTAPDLAQFAQRMSAQFAEM
NVTDLKHKFDEIMAGSSEAEPRQPDGDDGGDAVSGVAPGASAAGPSKTPALDTYTTNLTQRARDGKIDPV
IGREAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGAS
VKGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYK
KYFEKDAALARRFQVVKVEEPSEPLAAAMLRGMSGLMEKHFNVRILDDAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALAHSATPAAIDDTKKRIERIDAEIASLEREAAGGASHDERLGELRGARDTALAQLSDD
EARYEAERAIVAEITELRETLDRARHASEDGEPVDVPATREKLTERVAALHALQGGEPMVPLQVDGHVVA
EIVAAWTGIPLGRMVKDEIDTVLNLQPLLGARVIGQDHALDAIAQRVRTASANLEDPNKPRGVFMFVGPS
GVGKTETALALADILYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLD
EVEKAHPDVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSAAVMQACLNKTADELPDPDALAEAL
RPQLYKTFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVD
SGARNVDHILNGTLLPEIAGHVLGRIADGAAIARIAVRADDAGEFAYTVE
 
Nucleotide Sequence: 2673 bp     [Download]
>gi|134294128|ref|NC_009256.1|:501699-504371 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGAGCACGCCCCTGAAGACCCTGATCACGAAACTGAACCCGCTGTGCCGGCACGCGGCCGAACGCGCGG
CGAGCGCGTGCCTGGCGCGCGGCCATTACGAGGTCGATCTGGAGCACCTGTTCATCGCGCTGCTCGACGA
GGCGACGGGCGATCTGCCGCTCGCGTTGCGCGCGAGCCGCGTCGATCCGCATGCGCTGCGTGCCGATCTC
GAGCGCGAACTCACGCGGCTGAAGACGGGCAACACGCGCACGCCGGTGTTCTCCGTGCATCTGATCGCGC
TGTTCGAGCAGGCGTGGCTGATCGCGTCGCTCGATTCGCAGCTCGGCCGGATCCGCTCGGGCCATCTGCT
GCTCGCGCTGCTGACCGCGCCCGATCTCGCGCAGTTCGCGCAGCGGATGTCCGCGCAGTTCGCGGAAATG
AACGTGACCGACCTGAAGCACAAGTTCGACGAGATCATGGCCGGCTCGAGCGAAGCCGAGCCGCGCCAGC
CCGATGGCGACGACGGCGGCGATGCGGTGTCCGGCGTGGCGCCGGGCGCGTCGGCGGCCGGCCCGTCGAA
GACGCCCGCGCTCGACACGTACACGACGAACCTCACGCAGCGCGCACGCGACGGCAAGATCGACCCGGTG
ATCGGCCGCGAAGCCGAGATCCGCCAGGCGATCGACATCCTGATGCGCCGCCGCCAGAACAACCCGATCA
TGACCGGCGAGGCCGGCGTCGGCAAAACGGCGGTCGTCGAGGGGCTCGCGCTGCGGATCGCCGCGGACGA
CGTGCCGCCGCCGCTGCGCGGCGTCGCGCTGCACGTGCTCGACATGGGGCTGCTGCAGGCCGGCGCGAGC
GTGAAGGGCGAGTTCGAGAACCGCCTGAAGAGCGTGATCGACGAGGTGAAGAAGAGCGCGCACCCGATCA
TCCTGTTCATCGACGAGGCGCACACGATCATCGGCGCGGGCGGCCAGGCCGGCCAGAACGATGCGGCCAA
CCTGCTGAAGCCGGCGCTCGCACGCGGCGAGCTGCGCACGATCGCCGCGACGACGTGGAGCGAATACAAG
AAGTACTTCGAGAAGGATGCGGCGCTCGCGCGGCGCTTCCAGGTCGTGAAGGTCGAGGAGCCGAGCGAGC
CGCTCGCGGCCGCGATGCTGCGCGGGATGTCGGGGCTGATGGAGAAGCACTTCAACGTGCGGATTCTCGA
CGATGCGATCACCGAGGCCGTGCGCCTGTCGCATCGCTACATCAGCGGCCGCCAGCTGCCGGACAAGGCG
ATCAGCGTGCTCGACACCGCATGCGCGAAGGTCGCGCTCGCGCACAGCGCGACGCCGGCGGCGATCGACG
ACACGAAGAAGCGCATCGAGCGCATCGACGCGGAGATCGCGTCGCTCGAGCGCGAAGCGGCCGGCGGCGC
GTCGCACGACGAGCGGCTCGGCGAGCTGCGCGGCGCGCGCGACACGGCGCTCGCGCAATTGAGCGACGAC
GAAGCGCGCTATGAAGCGGAGCGCGCGATCGTCGCCGAGATCACCGAGCTGCGCGAGACGCTCGACCGCG
CGCGCCACGCTTCGGAAGACGGCGAGCCGGTCGACGTGCCGGCCACGCGCGAGAAGCTCACCGAGCGCGT
CGCGGCGCTGCATGCGCTGCAGGGCGGCGAGCCGATGGTGCCGCTGCAGGTCGACGGACACGTCGTGGCC
GAGATCGTCGCCGCATGGACGGGCATTCCGCTCGGCCGGATGGTGAAGGACGAGATCGACACCGTGCTGA
ACCTGCAGCCGCTGCTCGGTGCGCGCGTGATCGGCCAGGATCACGCGCTCGACGCGATCGCGCAGCGCGT
GCGCACCGCGAGCGCGAACCTCGAGGATCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCGTCG
GGCGTGGGCAAGACCGAGACGGCGCTCGCGCTGGCCGACATCCTGTACGGCGGCGAGCGCAAGATGGTCA
CGATCAACATGAGCGAGTATCAGGAGGCGCACAGCGTGTCGGGCCTGAAGGGCTCGCCGCCGGGCTACGT
CGGCTACGGCGAGGGCGGCGTGCTGACCGAGGCCGTGCGCCGCAATCCGTACTCCGTCGTGCTGCTCGAC
GAAGTCGAGAAGGCGCACCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCACGATGGACG
ACGCCGAAGGGCGCGAGATCGACTTCCGCAACACGCTGATCATCCTGACGTCGAACGTCGGGTCGGCCGC
GGTGATGCAGGCGTGCCTGAACAAGACGGCCGACGAGCTGCCCGACCCGGACGCGCTCGCCGAGGCGCTG
CGTCCGCAGCTGTACAAGACCTTCAAGCCGGCGTTCCTCGGCCGGATGAAGGTCGTGCCGTACTACCCGA
TTTCCGACGACGTGCTGGCCGAGATCATCGAGCTGAAGCTCGAGCGCATTCGCCGCCGCATCGAAGCGAA
CCACAAGGCCGCGTTCGAATGGGACGAGTCGCTCGTCGATGCGGTGCTCGCGCGCTGCACCGAAGTCGAT
TCGGGCGCCCGCAACGTCGACCATATCCTGAACGGCACGCTGCTGCCCGAGATCGCCGGCCACGTGCTCG
GCCGGATCGCCGACGGTGCGGCCATCGCGCGCATCGCCGTGCGCGCCGACGACGCGGGCGAATTCGCGTA
CACCGTCGAATGA