SecReT6
Protein ID: 134294579
SecReT6 ID198
T6SS typei4b
Gene symbol-
Locus tagBcep1808_0467
StrainBurkholderia vietnamiensis G4
Repliconchromosome I [GenBank: NC_009256] [Browse all T6SS(s) in this replicon]
Location [Strand]504411..505532 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA4JB26
KEGG IDbvi:Bcep1808_0467
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|134294579|ref|YP_001118314.1| ImpA domain-containing protein [Burkholderia vietnamiensis G4]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRHDDPTLDQGEWVTDIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDYWDTVHPLPEGDDVEYRLGNVAWLSGRTAELLRG
VAVTDGASNAFTTLDWEVAQHVAQAVKRDPEHAEEIARGKPSVEQIDASRRVTPIAFYTALLANLKAFEF
ALDAFEERLVERAGDSAPSFRQTRDAFETVYRLVERFAREQGYTGSAPHAPSAQQAQPERVEPSFGDAFH
TEETHVQTQTASRAPVAQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|134294128|ref|NC_009256.1|:504411-505532 Burkholderia vietnamiensis G4 chromosome 1, complete sequence
ATGCCGATCAATCTCCCCGAGCTGCTGACGCCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TCTCGAACGAATTCGACGCGATCCAGGATGCGCGGCGCCATGACGATCCGACGCTCGACCAGGGCGAATG
GGTGACCGACATCAAGGAGGCCGACTGGGGCTTCGTCGTCGACCATGCCGGCGAGCTGCTGCGCACGCGC
ACCAAGGACCTGCGGCTCGCCGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCACCGGCCTCA
CCGAAGGTTATGCGCTGCTGGAAGGCCTGTGCCGCGACTACTGGGACACCGTGCATCCGTTGCCCGAAGG
CGACGACGTCGAATACCGGCTCGGCAACGTCGCGTGGCTGTCGGGGCGCACGGCCGAGCTGCTGCGCGGC
GTCGCGGTGACCGACGGCGCGTCGAACGCGTTCACCACGCTCGACTGGGAGGTCGCGCAGCATGTGGCGC
AGGCCGTGAAGCGCGATCCCGAACACGCCGAGGAAATCGCGCGCGGCAAGCCGTCGGTCGAGCAGATCGA
TGCATCGCGGCGCGTGACGCCGATCGCGTTCTACACGGCGCTGCTCGCGAACCTGAAGGCGTTCGAGTTC
GCGCTCGACGCGTTCGAGGAGCGGCTGGTCGAACGCGCGGGCGATTCGGCGCCGAGCTTTCGGCAGACGC
GCGATGCGTTCGAGACCGTGTATCGGCTCGTCGAGCGTTTCGCGCGCGAGCAGGGATATACGGGCAGTGC
ACCGCACGCGCCGTCGGCGCAGCAAGCGCAGCCGGAGCGCGTCGAACCGAGCTTCGGCGACGCGTTCCAC
ACCGAGGAGACCCATGTGCAGACGCAGACCGCTTCGCGTGCGCCGGTGGCGCAAATGATCGCCGGCATCC
AGAACCGCGCGCAGGCCGTCGACCAGCTGCGCGCGGTCGCGCGTTACTTCCGCCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTCGCGGACAAGGCCGCGGAATGGGCCGACATGCCGCTGCACAAGTGGCTGGAGAGC
GTCGTGAAGGACGACGGATCGCTGTCGCATATCCGCGAGCTGCTCGGCGTGAGGCCCGACGAGCAGTCGT
GA