SecReT6
Protein ID: 134301194
SecReT6 ID472
T6SS typeii
Gene symboliglA1
Locus tagFTW_0038
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]34043..34597 [+]
Productintracellular growth locus, igl A
NoteIglA
UniProt IDA4IVU0
KEGG IDftw:FTW_0535, ftw:FTW_0038
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-43, Aligned region: 4..156
Protein Sequence: 184 a.a.     [Download]
>gi|134301194|ref|YP_001121162.1| intracellular growth locus, igl A [Francisella tularensis subsp. tularensis WY96-3418]
MAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVDAKKEFADREVRRVNNGVDRVLEEMN
ISFDFEAPNFVSKDRSNLKVNYRIESVKDFRPDAVAKKVPEIRALLEMKEILASFAKDIENNRNLKKTID
MIFSDSNELESLKSKIPALTNYTIKDSCDAAESQDLSNQQVDGK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|134301169|ref|NC_009257.1|:34043-34597 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGGCAAAAAATAAAATCCCAAATTCAAGGTTGATGATAAATTATGAAACTAATGTTGATGGTGTCTTAA
AGAAAAAAGAGCTACCTTACAGAGTCCTAGTTGTTGGCGATTTATCAAAAGGAAGATCTGTGGATGCAAA
AAAAGAGTTCGCAGATAGAGAGGTCAGAAGAGTAAATAATGGTGTTGATAGGGTTTTAGAAGAGATGAAT
ATATCTTTTGATTTTGAGGCACCAAACTTTGTTTCTAAAGATCGTAGTAATTTAAAAGTTAATTATAGAA
TTGAAAGTGTCAAAGATTTTAGACCTGATGCTGTTGCTAAAAAAGTTCCTGAAATCAGAGCGCTGCTTGA
AATGAAAGAGATATTAGCATCCTTTGCTAAGGACATTGAAAATAATCGTAATCTCAAGAAAACCATAGAT
ATGATTTTTTCAGATAGTAACGAATTAGAATCATTAAAGAGTAAGATTCCTGCTTTGACAAATTATACGA
TTAAAGACTCTTGTGATGCTGCTGAGTCTCAAGACTTAAGTAATCAACAAGTAGATGGTAAGTAG