SecReT6
Protein ID: 134301197
SecReT6 ID472
T6SS typeii
Gene symboliglD1
Locus tagFTW_0041
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]36798..37994 [+]
Productintracellular growth locus iglD
NoteIglD
UniProt IDA4IVU3
KEGG IDftw:FTW_0538, ftw:FTW_0041
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00095, Aligned region: 43..103
DUF876 [PF05936], Evalue: 0.00095, Aligned region: 185..345
Protein Sequence: 398 a.a.     [Download]
>gi|134301197|ref|YP_001121165.1| intracellular growth locus iglD [Francisella tularensis subsp. tularensis WY96-3418]
MFLERIYWEDGLRLDSDILDKSNLSVLERLSTASYLPANLNKGIVSFDLDVESLQTGLILIKDLKLYLDE
KNFVFYDKSYPLSLQIMTDKLSDEIPLFLNIREKVIEKNGIKYIYNQLSLSLEHSYGFKHSIQIALFRLD
RGRLVPEIYDFPLLTLNHYYLGDIFVKLNRTVSELKSFNRFVFSASRSYASILLVFLINKLERELKFAES
NRANSSPKQIFDLIDDIYSLIQLNLDKVEELDSIEFDFQKPLTKLNLLADRLLTLCEYRKINNFIRFELH
GKKYICESFPEEFFVATRYYLFLKRKATAPANVRFENKNALRITSISRNKNIVALSLSGVKLVDVECSMI
NFTTRFDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFDFFIAFS
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|134301169|ref|NC_009257.1|:36798-37994 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGTTTCTAGAAAGGATTTATTGGGAAGATGGTTTAAGATTAGATAGCGATATTTTAGATAAGTCAAATC
TATCTGTTTTAGAAAGGTTAAGCACCGCAAGCTATTTGCCAGCTAATCTTAATAAGGGAATCGTTAGCTT
TGATTTAGATGTTGAAAGTTTGCAGACAGGTCTTATCCTTATAAAAGATCTTAAATTGTACTTAGATGAA
AAAAATTTTGTTTTTTATGATAAGTCTTATCCGTTATCTTTACAAATAATGACTGATAAGTTAAGTGATG
AAATCCCCTTATTTCTGAATATCAGAGAGAAAGTAATTGAAAAAAATGGGATTAAATATATCTATAATCA
ATTGTCATTATCATTAGAGCATAGCTATGGTTTTAAACATAGCATCCAAATTGCATTATTTAGGTTAGAT
AGAGGGCGATTAGTACCAGAAATTTATGACTTCCCGCTATTAACTCTTAATCATTATTATTTAGGTGATA
TTTTTGTAAAACTTAATAGGACTGTTTCTGAACTAAAGTCTTTTAATCGCTTTGTTTTTTCAGCTTCAAG
ATCTTATGCGTCAATATTACTTGTATTTTTGATTAATAAATTAGAAAGAGAATTGAAGTTCGCAGAATCT
AATAGGGCAAATAGTTCCCCGAAACAAATATTTGATTTAATTGATGATATTTACAGCTTAATTCAACTTA
ACCTAGATAAAGTTGAAGAGCTTGATAGCATTGAATTTGATTTCCAAAAGCCTTTGACTAAATTAAATCT
ACTTGCTGATAGATTGTTAACTCTTTGTGAGTATAGAAAGATTAATAACTTTATCAGATTTGAATTGCAT
GGAAAAAAATATATATGTGAAAGCTTTCCTGAAGAGTTTTTTGTTGCTACTAGATACTATCTTTTCCTTA
AAAGGAAAGCAACAGCTCCAGCCAATGTAAGGTTTGAAAATAAGAATGCTCTGAGAATTACTAGTATAAG
TAGAAATAAGAATATTGTAGCTCTGTCTCTTTCAGGAGTAAAACTGGTTGACGTTGAATGTTCTATGATT
AATTTTACAACTAGATTTGATAATATCGATGCAATATATGAAATTCAAAAAGGTTCTGAGTGGGATTTTA
TATTAGCGGATAGTAGTGCGGTTTTTACGGCTTTTGAAGGTAGTGAGAATTTTGATTTCTTTATAGCCTT
TTCTTAA