SecReT6
Protein ID: 134301198
SecReT6 ID472
T6SS typeii
Gene symbol-
Locus tagFTW_0042
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]38001..38576 [-]
Producthypothetical protein
NotePdpE
UniProt IDA4IVU4
KEGG IDftw:FTW_0539, ftw:FTW_0042
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 191 a.a.     [Download]
>gi|134301198|ref|YP_001121166.1| hypothetical protein FTW_0042 [Francisella tularensis subsp. tularensis WY96-3418]
MSKKIFKLLSISIIFSIYQQTFSNTITASTFELKNSSKKNATIFLNLNEFCPTNIAACKDENDNNCIYIT
ELVREPLSRIYYYLAVPITSKSVKDLTILYKHDKEESPPEAINICLSLFKNNKHETYYSQVIYNWFVSSE
LYLSFSEGSIFINKDINNSNNYDKGNFLSVNLERIADGWAPPHYEKKITII
 
Nucleotide Sequence: 576 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c38576-38001 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGAGTAAAAAAATATTTAAATTATTATCAATTTCAATAATATTTAGTATATATCAACAAACATTTAGTA
ATACAATAACAGCTAGTACATTCGAACTAAAAAATAGTTCTAAAAAAAATGCTACTATCTTTCTAAATTT
GAACGAGTTCTGTCCGACTAATATAGCAGCATGCAAAGATGAGAATGACAATAATTGTATTTATATAACT
GAATTAGTTAGAGAACCTCTTAGTCGTATTTACTATTACTTAGCCGTGCCAATTACCAGCAAATCAGTTA
AAGACTTAACAATATTATATAAACATGATAAAGAAGAATCTCCACCAGAAGCAATAAATATATGTTTGAG
TTTATTTAAAAATAATAAGCATGAAACATACTATTCTCAAGTTATATATAATTGGTTTGTATCTTCAGAA
TTATATTTATCATTTAGTGAAGGATCTATTTTTATAAATAAAGATATTAATAATTCTAATAATTATGATA
AAGGTAATTTTCTAAGCGTAAATCTCGAACGTATAGCTGATGGCTGGGCTCCTCCTCATTATGAAAAGAA
AATTACTATAATATAA