SecReT6
Protein ID: 134301200
SecReT6 ID472
T6SS typeii
Gene symbol-
Locus tagFTW_0044
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]42620..43336 [-]
Producthypothetical protein
NoteIglJ
UniProt IDA4IVU6
KEGG IDftw:FTW_0044, ftw:FTW_0541
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 238 a.a.     [Download]
>gi|134301200|ref|YP_001121168.1| hypothetical protein FTW_0044 [Francisella tularensis subsp. tularensis WY96-3418]
MQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTILDIYDNKETLNVKINIFKIKPFTKL
QSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDTKALHKFTTKNSYYIQCAPKYTIDNIINNIYKLLSED
YCTVIDYKEKLINIKRKQIVVGDSYVGKSFLGAYIPSYVYIINIKIYLISKNQYVINKIKTQIKKIEEKI
TNLPFKIELEISIENNKKNQIYLGYFNL
 
Nucleotide Sequence: 717 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c43336-42620 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGCAACACATCAATAATATCAATAAAAATATCTCTCTAAATAACTTTGTAAGTCTTCTAAAAAGTCAGA
AATATTCTTTGAAAAGAATAAATTTCATACCGGTAATGATTAATAAAACCTCATCTCCTACCATATTAGA
TATTTATGATAATAAAGAAACTCTAAATGTAAAAATAAATATCTTTAAAATCAAACCATTCACTAAATTA
CAGAGTATTTATCAAGAATATATCCAAAACAATAATGACTTGGCTATTGAAATACTTGGATACGGATTAA
AAGTGCTACTAAAGTTATACATTTTAGATACTAAAGCACTGCACAAATTCACAACAAAAAATAGTTATTA
TATTCAATGTGCTCCCAAATACACTATAGATAACATAATAAACAATATCTATAAATTACTCTCGGAAGAC
TATTGCACAGTAATAGATTATAAAGAAAAACTAATCAATATAAAGAGAAAACAAATAGTAGTAGGAGATT
CTTACGTTGGAAAATCTTTCTTGGGGGCATATATTCCCTCATATGTTTATATTATAAACATTAAGATATA
TCTCATTAGTAAAAATCAATATGTCATAAATAAAATCAAAACTCAAATTAAAAAAATTGAGGAAAAAATT
ACAAATCTCCCATTTAAGATAGAACTTGAAATATCAATTGAAAATAATAAAAAAAATCAGATATACCTAG
GTTATTTTAATTTATGA