SecReT6
Protein ID: 134301203
SecReT6 ID472
T6SS typeii
Gene symbol-
Locus tagFTW_0047
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]45168..46598 [-]
Producthypothetical protein
NoteIglH
UniProt IDA4IVU9
KEGG IDftw:FTW_0544, ftw:FTW_0047
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|134301203|ref|YP_001121171.1| hypothetical protein FTW_0047 [Francisella tularensis subsp. tularensis WY96-3418]
MDEKRKDLSTNDASILKKTFDKLSNDIRDDFDKRIFDYSNTLLFKYYSNLYYFVPKSCLLEINDKGHNGY
YIPPQEYFFIEDKRTGKTLTYTTKSENIILPIRDITTIKQSDTSINISLEFANNFDYDYVTIWIDPTLCK
EDPSFATYIFNQVLEDNGSAKIKFSNHSYTTKNVQIEPIKFQLKPTEKLVLNIHSPSLLYGFNIKIKDLF
KYKNNDLNKIDFFLEVKTENYNDEKLSSLFRVNLIPVFNSFDDYSSTSFASMNLSESKLKHHQKDDAQAI
EVLSVYENNKQCDFNSFLFVGQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQITEISDLIEI
NSNAIASISCNISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTFLAIAKLLKINTNDLTLLSMLL
QDVEMDSTINELILTLSDKYNPKYKHFLNFHIGIICKFINQNTFSFIKKIVLNNSI
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c46598-45168 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGGATGAAAAAAGAAAAGATTTAAGTACGAATGATGCTAGCATCCTAAAAAAAACTTTTGACAAACTAA
GTAATGATATAAGAGATGATTTTGATAAGAGAATTTTTGATTATAGTAATACTCTTTTATTCAAGTATTA
TAGTAACCTTTATTATTTCGTTCCTAAATCATGCTTATTAGAAATAAATGATAAAGGACACAATGGTTAC
TATATTCCGCCTCAGGAATATTTTTTCATAGAAGACAAGAGAACAGGTAAAACTCTAACATATACGACAA
AGTCAGAAAATATAATACTCCCTATTAGAGATATCACAACCATAAAACAAAGTGATACATCAATAAATAT
ATCATTGGAATTTGCAAATAACTTTGACTATGATTATGTTACTATCTGGATAGATCCAACTTTATGTAAA
GAAGATCCTAGCTTTGCCACATACATATTTAACCAAGTATTAGAAGATAATGGCTCAGCAAAGATTAAAT
TTTCAAATCATAGTTATACAACAAAAAATGTACAAATAGAACCAATTAAGTTCCAATTAAAACCAACAGA
AAAATTAGTTCTCAATATCCATTCTCCTAGCCTTTTATATGGTTTTAACATAAAGATCAAAGACTTATTT
AAATACAAAAATAATGACCTCAACAAAATTGACTTTTTTTTAGAAGTTAAAACTGAAAACTATAATGACG
AAAAATTATCATCTCTATTTAGAGTTAATTTAATACCTGTGTTTAATAGTTTTGATGATTACTCAAGCAC
CTCATTTGCTTCGATGAATCTCTCAGAGAGTAAACTAAAACATCATCAAAAAGATGATGCTCAAGCAATA
GAAGTATTATCTGTTTATGAGAATAATAAACAATGTGATTTTAATAGTTTTCTTTTTGTAGGACAGAATG
AGTATTATTTTAATCGCAGCACACAATCTTTAAATTATAGTAGCGTACTCCCTCAATTTAGTAATAAAAT
AATAGGAACAAAAATACATACATATACAACCTGGACACAGATAACTGAGATTTCTGATCTAATTGAAATT
AACTCAAATGCAATAGCATCTATAAGCTGTAATATTTCTCCAATAGTTATTAACAAAGCACTAAACAACT
ACAATAGCAATGCTAAAGAAATGTTTAATATAATAGATATGATCATCTCTAAGAATATGTATTCAAAAAC
AACATTCCTAGCTATAGCAAAGCTTTTAAAGATTAATACTAATGACTTAACTTTACTATCAATGCTCCTA
CAAGATGTTGAGATGGACTCTACTATAAATGAGCTAATTTTAACCTTAAGTGATAAATATAACCCAAAAT
ATAAACATTTCTTAAATTTTCATATTGGTATTATATGCAAATTTATAAATCAAAACACCTTTAGCTTTAT
TAAAAAGATTGTTTTAAATAACTCTATATAA