SecReT6
Protein ID: 134301205
SecReT6 ID472
T6SS typeii
Gene symbol-
Locus tagFTW_0049
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]47133..48863 [-]
Producthypothetical protein
NoteIglF
UniProt IDA4IVV1
KEGG IDftw:FTW_0049, ftw:FTW_0546
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 576 a.a.     [Download]
>gi|134301205|ref|YP_001121173.1| hypothetical protein FTW_0049 [Francisella tularensis subsp. tularensis WY96-3418]
MNNNIDKWFENLFSNIHLYYKQEQSYKISKLNECITNVIKFINIKDYRKADIYNLTYVIEDVRYSTNLIL
SDSAIKFNDLILKKLDNLLDCTDINYFTSLMKNLKVLLEKYKLVIEKDISNRIELIKTKQIDKLESIFLD
YINNHSISAYDDSLVKLYVKTIQNPNSIEAIDEYKSYFDTLKIFIKDHKNIVSFIPFRKNPILSLLKLAY
LIRTGLYKTDRLLASDIILLRALYSINKDTYKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIDFIDLQ
IFAISQYFDDFPLQDIFFQKKSQIDIFKSESLEQLIFSLKSISNIMFDEETLYKKIHIKNQLYKNLFLNN
HNSLIEDIIEKSPANLLTKLANKYFQILLDIATIINIQLVSNNLKLIYPFLEFEKYFNQVTLEVSKKSQF
NQEKLEKNILNIIRIYPLLNQNYQLLKDMEQKIIDDKNSIESNDIYKLSVFVNSKSFSTYKEIRTLTSND
HKDINIHKSLAKLNKNICNAKHKNAAETAKELTMVLLSKSYYMNPTLIGVYNLPPISNSFFLVLKEITNN
PIIDSIKSKQEAYWKI
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c48863-47133 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGAATAATAATATTGATAAATGGTTTGAGAATTTATTTAGCAATATCCATTTATATTATAAACAAGAGC
AATCTTATAAAATAAGTAAGCTTAATGAGTGCATCACTAACGTAATCAAATTTATAAATATAAAAGATTA
TAGAAAAGCTGACATCTATAATCTGACCTATGTTATTGAAGATGTAAGATACTCAACGAATCTAATTTTA
TCTGACTCTGCAATTAAATTTAATGATTTAATATTAAAAAAATTAGATAACCTCTTAGATTGTACTGACA
TTAACTATTTTACTAGCCTTATGAAGAATTTAAAGGTTCTTTTAGAAAAGTATAAACTAGTAATAGAGAA
AGATATATCGAATAGAATAGAACTTATAAAAACTAAGCAGATCGATAAACTAGAATCTATATTTTTAGAC
TATATAAACAACCATAGTATCAGCGCTTATGATGATAGTCTTGTAAAATTATATGTAAAAACTATACAAA
ATCCCAATTCCATTGAGGCTATAGATGAGTATAAATCATATTTCGATACGCTCAAAATATTTATAAAAGA
TCATAAAAATATAGTTAGTTTTATTCCCTTTAGAAAAAATCCTATTTTAAGCTTATTGAAATTAGCTTAT
TTAATTAGAACTGGTTTATATAAAACAGATCGTCTTTTAGCTAGCGATATTATTCTTTTAAGAGCTTTAT
ATTCTATAAATAAAGATACATATAAATTAAGTCTTATAAATGAAAAAACAGATACTAACCTATCAATAGT
TTCGCTGACGTCACTACAAGCTAAGCCCTCAGAAAACTTAAAAAAAACTATTGATTTTATAGATTTACAG
ATATTTGCTATATCTCAGTATTTTGATGATTTCCCTTTACAGGATATTTTTTTTCAAAAAAAATCACAAA
TAGACATTTTCAAGTCAGAATCACTAGAACAACTTATTTTCAGTTTAAAAAGTATTTCAAATATAATGTT
TGATGAAGAAACACTATATAAAAAAATCCATATAAAAAATCAACTCTACAAAAACCTTTTTTTAAATAAT
CACAATAGTTTGATAGAAGATATTATAGAAAAATCTCCAGCAAACTTATTAACAAAGTTAGCTAATAAAT
ACTTCCAAATACTGCTAGACATAGCAACAATAATAAATATTCAATTAGTAAGTAATAATTTAAAGCTTAT
TTATCCTTTCTTAGAGTTTGAAAAATATTTTAATCAAGTAACTTTAGAAGTATCAAAAAAATCACAGTTT
AATCAAGAAAAGCTAGAAAAGAATATTCTAAATATTATCAGGATATATCCTTTACTAAATCAAAACTACC
AATTATTAAAGGATATGGAACAAAAAATTATTGATGATAAAAATAGTATAGAATCAAACGATATATATAA
GCTTAGTGTTTTTGTAAATAGCAAAAGTTTTTCTACCTATAAAGAAATCAGAACCTTAACCTCAAATGAC
CATAAAGATATTAACATCCACAAATCTTTAGCAAAACTGAACAAAAATATTTGTAATGCCAAACATAAGA
ATGCCGCTGAAACAGCTAAAGAGCTAACGATGGTTCTTTTAAGTAAATCTTACTATATGAATCCAACTTT
GATAGGAGTATATAATCTACCGCCAATTTCAAATAGTTTTTTTTTGGTGCTTAAAGAGATTACAAATAAT
CCGATCATTGATAGTATAAAAAGCAAGCAAGAAGCTTATTGGAAAATTTAA