SecReT6
Protein ID: 134301207
SecReT6 ID472
T6SS typeii
Gene symbol-
Locus tagFTW_0051
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]49375..49752 [-]
Productlipoprotein
NoteIglE
UniProt IDA4IVV3
KEGG IDftw:FTW_0051, ftw:FTW_0548
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 125 a.a.     [Download]
>gi|134301207|ref|YP_001121175.1| lipoprotein [Francisella tularensis subsp. tularensis WY96-3418]
MYNKLLKNFCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLN
LKTGKNEFPLDKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD
 
Nucleotide Sequence: 378 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c49752-49375 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGTACAATAAATTATTGAAAAATTTTTGTTTAGTATTATCCACAATCATAGGGCTTAGCAGTTGTATTA
GTGATGGTTTGTATATCAACAACAATATTCCTAAGACAAAAATAGTTCTAGAATCTAAACCTGATAAAAA
TATTTTCTACTCAGATAACTATCAATCTATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAAT
CTTAAAACAGGAAAGAATGAATTTCCATTAGATAAAGATATCAAGGATTATGCCTTGTATTTTATACTTC
CTGAAAATAAAAAAACTGAAAACTGGAAATACATAATAAGTTCAGATTCTGTAAATAAATTTACTATAAA
AAATGATAGTAGCATAGAAAAAGATTAA