SecReT6
Protein ID: 134301209
SecReT6 ID472
T6SS typeii
Gene symbolpdpA1
Locus tagFTW_0053
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]53028..55490 [-]
Productpathogenicity deteminant protein pdpA1
NotePdpA
UniProt IDA4IVV5
KEGG IDftw:FTW_0053, ftw:FTW_0550
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 820 a.a.     [Download]
>gi|134301209|ref|YP_001121177.1| pathogenicity deteminant protein pdpA1 [Francisella tularensis subsp. tularensis WY96-3418]
MIAVKDITDLNIQDIISQLTSEVINGDTTSSSAKFACEINSYIINYKLLNINLINTQLKNTKILYRKGLI
SKLDYEKYKRYCVICRLKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLT
SIDSAIQRSSDLNKTIIKQLNKLKSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFK
HNSLTLKNPHIEKLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKD
HHKRTTRFMAIGFNSNSIDIHENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPSYIALNKSLDD
IFKENFFFDNLVSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNKCYLKYFCDKKSGKVSYHVVD
QVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLNTQKKEDRKISDTLIK
PFSSILKDNLQSIEYIQSNNDDIQEIITTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLY
ISQRKLLFKRSKYCSKQLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNLITYKIKDYSNLTPEYPKY
KSFSNFYINGRVTIGENVNNDSKKAYKFFKNYKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEM
LSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEMQSFTKGEIIELISNSAISTKKAQQQLLQRQL
LGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIFLRYKSKGN
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c55490-53028 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGATAGCAGTAAAAGATATAACTGATTTAAATATACAAGACATAATTAGTCAGTTAACTTCTGAAGTTA
TAAATGGCGACACAACCTCTTCTTCTGCCAAGTTTGCTTGTGAAATTAATAGCTATATTATTAATTACAA
ACTATTAAACATTAATCTTATTAATACTCAACTAAAAAATACAAAGATACTTTATAGAAAAGGCTTGATA
TCTAAGCTTGATTACGAAAAATATAAAAGATATTGCGTAATATGTAGATTAAAAAATAACATAGATGAAT
TTATCTTATATTTTTCGACAAACTATAAAGACTCTCAAAGCTTAAAAATCGCAATTAAAGAATTACAAAA
CTCATGCTCATCAAGTTTAATTCTTGAGCTCCCTCATGATTACATAAGAAAAATTGATGTCTTACTAACT
AGTATAGATAGTGCGATACAAAGATCAAGTGATCTCAACAAAACAATTATAAAACAGTTAAATAAGCTTA
AAAGCAGCCTTTCACGATATATTGGGTATAATAATGTACTGCAAAAACAAGAAATTACTATAAATATAAA
GCCTATTAATAAAAATTTTGAACTTGAGGATATAAGTTTTGTATCAACTAGAAATAAGCAATATTTTAAG
CATAACTCTCTTACACTTAAAAACCCTCATATTGAAAAATTAGAAGTATGTGAAAATATCTACGGCATAA
ATGGCTGGTTAACTTTTGATTTAGCATATATCAATAATCACAAAGACTTTAACTTCCTATTAAGCCCAAA
TCAACCCATATTACTTGATATTCAAATTAATGATAGCTTCAATTTTTACAAAAAAGAATCTAAAAAAGAT
CATCATAAGAGAACAACCCGTTTTATGGCCATTGGCTTTAATTCAAACAGTATAGATATTCATGAGAACT
TTGAATACAGCATATATTCTTATACCAAAAATGTTTCTTCAGGAGTAAAAAAATTTAAAATACAATTCCA
TGACCCACTAAAAGCACTTTGGACTAAGCACAAACCATCTTATATAGCTTTAAATAAAAGCTTAGATGAT
ATCTTTAAAGAGAATTTTTTCTTTGATAATTTAGTTTCTTTAGATACCAACAAAAGTAATAACCTAAAAA
TACGTATACCACAAGCATTTATTTCTACAGTTAATCGAAATTTTTATGATTTTTTTATTCAACAACTTGA
GCAAAATAAATGCTATTTAAAATATTTCTGTGATAAGAAGAGTGGCAAAGTAAGCTATCATGTTGTAGAT
CAAGTAGATAATGACTTACAAAGGAATATCGTAAATTCAGATGAAGATTTAAAAGACAAACTATCTCCTT
ATGATATAAGCTGCTTCAAAAAACAAATTCTAATCTCAAATAAATCAAACTTTTATGTTAAAGAAAAAAA
TATATGTCCTGATGTGACTTTAAACACTCAAAAAAAGGAAGATCGAAAGATTTCAGATACCTTAATAAAG
CCATTCTCATCCATACTCAAGGATAACTTACAATCTATAGAGTATATACAAAGCAATAATGATGATATAC
AAGAAATTATTACTACAGGATTTGAGATATTACTGACATCAAGAAATACTCTGCCCTTCTTAGATACTGA
AATTACTCTTTCTAAACTAGACAATGATCAAAACTATCTTTTAGGCGCAACAGATATAAAAAGCTTATAT
ATAAGTCAAAGAAAGCTATTATTTAAAAGAAGTAAATACTGCTCTAAACAACTATATGAAAACTTACATA
ATTTTCACTATAAAAGTGATTCTGAATCAGACGTATATGAAAAAATTGCTTTTACTAAATACCCTAGTCT
GACACATGACAACTTAATAACTTATAAAATTAAGGATTATAGTAATCTAACTCCTGAATATCCTAAGTAC
AAAAGTTTTAGTAACTTTTATATTAATGGTAGAGTAACGATTGGAGAAAATGTTAATAATGACTCCAAAA
AAGCTTATAAATTCTTTAAAAATTATAAGCCAGAAGAAAGCTCAATCGCAGAATTTCAAGAAAATGGTGA
AAAAGGTACTTCAGCTATACTAAATAGTAAGGCTGATATCTTATACGCAATAGAAATTGCCAAGGAAATG
TTATCTGATAAATCATCAGATAAGCCAATCATATACTTACCTCTAAAAGTAAACATAAATTCTGCTAATA
ATCAATTTATACCATTGAGAAATGACGATATTATCTTAATTGAAATGCAGTCTTTTACTAAAGGTGAAAT
TATTGAGTTAATTTCGAACTCTGCCATATCAACAAAGAAAGCTCAGCAGCAACTACTACAACGACAACTT
CTTGGATCTAAAGAAAACTGTGAAATGGCATATACCCAAACAAGTGATAGCGAGACATTCTCACTAACTC
AAGTAAATGAAGATTGTGAGAATTCTTTTTTGATAAATGATAAAAAAGGTATTTTTCTAAGATATAAATC
AAAAGGAAATTAA