SecReT6
Protein ID: 134301596
SecReT6 ID473
T6SS typeii
Gene symbolpdpD2
Locus tagFTW_0534
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]520088..523675 [+]
Productpathogenicity determinant protein D, pdpD
NotePdpD
UniProt IDA4IVT9
KEGG IDftw:FTW_0037, ftw:FTW_0534
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1195 a.a.     [Download]
>gi|134301596|ref|YP_001121564.1| pathogenicity determinant protein D, pdpD [Francisella tularensis subsp. tularensis WY96-3418]
MDQDINDLLYDTNDLKKEKVCGGFFDFIKAWFYNDVERHMFFEDEIIVAQKLKTMDVMANTYALERKKYF
EKFLKDSHKQKGFFTRIKDRDFAFYKDPTRVKLWSSITDTDVYSFFIKSSVNQVLGGGNIAQLTSLPKFK
FNAIASVNNENISAAANLAATGAKSFFGSSCINIWSNLPVFDSERGDVKSFIPLYLRISGKASSALFNYN
IDISASTNRLKFTESKCMELLNNFKGNVNLRLVAAKSSREAKSFIYTPKFKEDSNKHLNDLGFILNTQQG
SYRYLVPEIRDGLDLIREYTYPEIEQIYFGRSALSGYSKSNYDKQSLGIEKNGEGLMTLRVSSKDYENPL
IQVKTSVNVTSFDLLSGQIKGKILADDLIGFSDAKGAINKFRNEVDTIIKNNISESFKSPFKIPNLSEFS
DMEIRVRFGLYSKQSASKLRTIRISIPMTTKMLDFNQTSGSYNTKSGMGYSMAQRHQLKEAIPYNEGLLE
NSAQQDFDLVKPTGNSTLGAVQDNLSNIYDKSSTFDSVIGSLRELYKLKGEDLTNIDSHDILNVLSQNSS
LSGLSSSIAADLNELNSKFKDITSINKKTSEAILSTNYQQYNPSFNKAKIFDNPDSFYVQDTLINYSQTL
KKEEFRDQMSTINIIEFGSDGDLPILFNLCKMMTSESAKDGAKNFLSQKENVNKTKEFFDALENTTSVIS
PESNISYTSINVLCSKNAGGVITENNKASSVSLGSTISLADFNRMYSLDSRVSVLGVSPLEELSSFSAKK
NEYKITFEEYFTKLAIQRYMEVIMIDDEADFIKSFVLPMMECQKKLLDNLVILNKDAKWKSSSSFKRAFS
NRGSFSFTGWLKERLPGFDFELSQEYAYFTGLVINFAFEEDNSSSETVIKLCKIIKSLDRLVRGFYFLLR
RMVKNRNTKVGSHNVSESHINMVKQILTSLCEPYQILTQKVSDNAELLSALVNMLSFMDSLVEVQRLCAS
ICIPTSAFFTLVNENKNLLKDICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNTSVRVRDGKV
KRVTSIDRNANTEAILQSIYDNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIGLTYHPITNNAFVE
FNKDQQSLLYSYNNLSKDAYVTKIKSIVDAKVALNLSFEHEEIRSSQGFSVLATVPARGYSIDDLNRKYR
PMIWV
 
Nucleotide Sequence: 3588 bp     [Download]
>gi|134301169|ref|NC_009257.1|:520088-523675 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGGATCAAGATATCAATGATTTATTATATGATACTAATGATTTGAAAAAAGAAAAAGTATGTGGCGGCT
TTTTTGATTTTATCAAAGCTTGGTTTTATAATGACGTTGAAAGACATATGTTTTTTGAAGATGAGATTAT
TGTGGCTCAGAAACTTAAAACGATGGATGTCATGGCTAATACATACGCCTTAGAGAGAAAAAAATATTTT
GAAAAATTTCTCAAAGATTCTCATAAACAAAAAGGTTTTTTTACAAGAATAAAAGATAGAGATTTTGCTT
TTTATAAAGATCCTACTAGGGTTAAACTATGGAGTAGTATTACTGATACTGATGTCTATAGCTTTTTTAT
AAAGTCAAGCGTTAACCAAGTGCTTGGTGGTGGTAATATAGCTCAACTGACATCATTACCAAAATTTAAG
TTTAATGCAATAGCATCAGTTAATAATGAAAACATCTCGGCAGCAGCTAATCTTGCAGCTACTGGAGCAA
AAAGTTTTTTTGGAAGTTCATGTATAAATATTTGGTCTAATTTACCTGTATTTGATAGTGAAAGAGGAGA
TGTTAAATCATTTATTCCATTATACCTAAGAATAAGTGGTAAAGCTTCATCGGCATTATTTAATTATAAT
ATAGATATAAGTGCTAGCACAAATAGATTAAAATTTACTGAATCAAAATGCATGGAATTATTAAATAACT
TTAAGGGCAATGTAAATCTTAGATTAGTGGCTGCAAAAAGCTCTAGAGAAGCAAAAAGCTTTATTTATAC
TCCAAAATTTAAAGAAGATAGTAATAAGCATTTAAATGATTTAGGTTTTATTCTAAATACTCAGCAAGGT
TCATATAGATATTTAGTTCCTGAAATTAGGGATGGACTTGATCTAATTAGAGAATATACATACCCCGAAA
TTGAACAGATTTATTTTGGTAGGAGTGCACTTTCTGGTTATTCAAAAAGTAATTATGACAAGCAAAGTTT
AGGTATTGAGAAAAATGGTGAGGGTCTTATGACTCTTAGGGTTAGTTCCAAAGATTATGAAAATCCACTA
ATTCAGGTCAAAACTTCAGTTAATGTAACTAGTTTTGATCTTTTATCAGGACAAATAAAAGGTAAGATTT
TAGCTGATGACTTAATTGGTTTTTCAGATGCTAAAGGTGCTATTAATAAGTTCAGAAACGAAGTTGATAC
AATTATTAAAAACAATATTAGTGAAAGCTTTAAGTCTCCTTTTAAGATACCAAACTTATCTGAATTTAGT
GATATGGAGATAAGAGTGAGGTTTGGCTTATATTCTAAACAATCAGCATCCAAGTTGAGGACCATAAGAA
TCTCTATTCCTATGACTACTAAAATGTTAGATTTTAATCAAACATCTGGGTCATATAATACAAAATCAGG
TATGGGTTATTCAATGGCTCAGAGACATCAATTAAAAGAAGCAATACCTTATAATGAAGGTCTTCTAGAA
AATTCTGCTCAGCAGGATTTTGATTTGGTTAAACCAACCGGAAATAGTACTCTTGGAGCTGTGCAAGATA
ATTTATCAAACATATATGATAAAAGTAGTACGTTTGACTCAGTAATAGGTTCTTTGAGAGAGCTTTATAA
ACTTAAAGGTGAAGACCTAACAAATATTGATTCTCATGATATCCTTAATGTTTTATCACAAAACTCGTCT
TTATCGGGGTTATCTAGTAGTATCGCAGCAGATCTAAATGAGTTAAACTCTAAGTTTAAGGATATTACGT
CTATAAATAAAAAAACATCTGAAGCGATATTATCTACGAATTACCAGCAATATAATCCTAGTTTTAATAA
AGCAAAAATATTCGATAATCCAGATTCTTTCTATGTTCAAGATACTTTAATTAACTACTCACAAACCCTA
AAAAAAGAAGAATTTAGAGATCAGATGTCAACAATAAATATTATTGAATTTGGTAGTGATGGTGACTTAC
CTATATTATTTAATCTTTGTAAAATGATGACTAGCGAGTCAGCAAAAGATGGCGCAAAAAATTTTCTAAG
TCAAAAGGAGAATGTTAATAAGACTAAAGAGTTTTTTGATGCTCTAGAAAATACCACTTCTGTAATAAGT
CCAGAATCAAATATCAGTTATACATCTATTAATGTGCTTTGTAGCAAAAATGCTGGAGGTGTAATTACTG
AGAATAACAAAGCATCTTCTGTATCCCTAGGTTCAACTATTAGTTTAGCGGATTTTAATAGAATGTATTC
GCTTGACTCAAGAGTTTCTGTGCTTGGAGTATCTCCTTTAGAAGAGTTATCAAGTTTTTCAGCGAAAAAA
AATGAATATAAAATCACTTTTGAAGAATATTTTACTAAGTTAGCGATTCAAAGATATATGGAAGTTATTA
TGATAGATGATGAAGCTGACTTTATAAAATCATTTGTATTACCAATGATGGAGTGTCAAAAGAAACTATT
AGATAATTTAGTTATTCTAAATAAGGATGCTAAATGGAAAAGTAGTTCATCATTTAAGAGAGCTTTCTCA
AATAGAGGTAGTTTTAGTTTTACTGGTTGGCTTAAAGAGAGACTTCCTGGCTTTGATTTTGAGCTTTCTC
AGGAGTATGCTTATTTTACTGGCTTAGTAATAAACTTTGCCTTTGAAGAAGATAACTCTTCTTCTGAAAC
TGTAATTAAACTATGTAAAATTATAAAATCTTTAGATAGGCTTGTTCGAGGTTTTTATTTCTTACTAAGA
AGGATGGTGAAAAATAGAAATACTAAAGTTGGTTCTCATAATGTCTCTGAAAGTCACATTAATATGGTTA
AGCAGATTTTAACATCCTTATGTGAACCATATCAGATTTTAACTCAGAAGGTAAGCGATAATGCTGAACT
GTTGTCTGCTTTAGTTAATATGTTGAGTTTTATGGATAGCCTTGTTGAAGTACAGCGGTTATGTGCTTCG
ATTTGTATTCCAACCAGTGCATTTTTCACTTTAGTGAATGAAAATAAAAATTTGTTGAAAGATATTTGCT
ACACTGTCGAAAAAAGTGGTGTTACAGGAATAGTGGTTGAATCGACATTTAGCTATTCGCCAGAACTCTT
CAAAGAAAATCAACAAGATATTAAGCTTAACATTAAAAACACGTCAGTCAGAGTACGAGATGGTAAAGTC
AAGAGGGTTACCAGCATTGATAGGAATGCTAATACTGAAGCTATCTTACAAAGTATTTATGATAATATAA
TTGCGTTTGATGAACAAGATTTAGAAAGACTATTTACGGGGTTTAGGATTTTAAAACAAGAAAATTCGAC
AAACACTAATAAAGCCGTTTTCAATATTGGTTTAACATATCATCCAATAACTAATAATGCTTTTGTTGAA
TTTAATAAGGATCAACAAAGTTTATTGTACTCATATAATAATTTAAGCAAAGATGCGTATGTTACAAAAA
TTAAAAGTATAGTTGATGCTAAAGTTGCTTTAAACCTTAGTTTTGAACATGAAGAGATTAGAAGTTCACA
AGGTTTTAGTGTCTTAGCAACTGTACCAGCTAGAGGATATTCTATAGATGATTTAAATAGAAAGTATAGA
CCAATGATCTGGGTTTAA