SecReT6
Protein ID: 134301598
SecReT6 ID473
T6SS typeii
Gene symboliglB2
Locus tagFTW_0536
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]524324..525844 [+]
Productintracellular growth locus iglB
NoteIglB
UniProt IDA4IVU1
KEGG IDftw:FTW_0039, ftw:FTW_0536
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-144, Aligned region: 73..497
Protein Sequence: 506 a.a.     [Download]
>gi|134301598|ref|YP_001121566.1| intracellular growth locus iglB [Francisella tularensis subsp. tularensis WY96-3418]
MTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLSTDYNARNLMALSLVLANNDNINNYNQ
KYIQKVITVIDKLIDLQVNSIISNDEFRALEQEWLKVQEVCQEDYDNVEVSILDVKKEELQYDFERNLYD
ISSSDFFKKVYVSEFDQYGGEPYGAILGLYNFENTTNDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDL
SEITHIKSFEALLEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYDKN
ESYLWGPASIHLVKNMMRSYDKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNVLFADYMELSL
ANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYTMCISRISHYIKCVIRDKIGSI
VDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVSIEVKTIPGKPGWYSCKINVIPHIQFEGMNTTM
TIDTRLEPELFGTNNN
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|134301169|ref|NC_009257.1|:524324-525844 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGACAATAAATAAATTAAGTCTCACTGATGAACTTTTAAATAATTTTGGGGGATCTACAGAAGTTGATA
GTGTACTCAAAAATATAGATTTTGATGTTTCAGATGATGCTTCTAAAGTTTTATCTTTATCTACTGACTA
CAATGCTAGAAACCTTATGGCGCTATCTTTGGTATTAGCAAATAATGATAATATAAATAATTATAATCAA
AAATATATCCAGAAAGTTATTACAGTTATTGATAAGCTTATTGATTTACAAGTTAATTCTATTATATCTA
ATGATGAGTTTAGAGCACTTGAGCAAGAATGGCTAAAGGTGCAAGAGGTTTGTCAAGAAGACTATGATAA
TGTTGAAGTAAGTATATTAGATGTAAAAAAAGAAGAGCTACAATATGATTTCGAGAGAAATTTATATGAT
ATATCTAGTAGTGACTTTTTCAAAAAAGTTTACGTTTCAGAATTTGATCAATATGGTGGCGAACCTTATG
GCGCAATATTAGGATTGTATAATTTTGAAAATACCACAAATGATATAATTTGGTTGACTGGAATGGGTAT
GGTGGCAAAGAATTCTCATGCACCATTTATTGCATCAATTGATAAGTCATTCTTTGGTGTTAAGGATTTA
TCAGAAATCACTCATATAAAAAGTTTTGAAGCTTTGCTTGAGCATCCTAGATATAAAGAGTGGAATGATT
TTAGAAACCTTGATGTTGCTGCATATATAGGTTTGACCGTAGGTGATTTTATGTTGCGGCAACCATATAA
TCCTGAGAATAATCCAGTTCAGTATAAACTTATGGAAGGCTTTAATGAGTTTGTTGATTATGATAAGAAT
GAAAGTTATCTATGGGGACCTGCTTCAATTCATCTAGTTAAGAATATGATGAGATCTTATGATAAAACTA
GATGGTTCCAATATATAAGAGGAGTTGAGAGTGGTGGTTATGTAAAGAACTTGGTAGCTTGCGTATATGA
TAATAAAGGCATTCTAGAAACTAAGTCACCTTTAAATGTATTATTTGCTGATTATATGGAGTTATCACTT
GCAAATATTGGTTTAATACCATTTGTAAGTGAAAAAGGTACTAGTAACGCTTGTTTCTTTAGTGTAAATT
CTGCTAAAAAAGTCGAAGAATTTGTAGATGGATTTGACTCAGCAAACTCAAGATTAATTGCTAACCTTTC
TTACACTATGTGTATATCGAGAATATCTCATTATATTAAATGTGTAATTAGAGATAAGATTGGTAGTATT
GTGGATGTCGAGTCGATTCAAAAAATTCTTTCTGATTGGATATCAGAATTTGTCACCACAGTCTATCAAC
CAACCCCTTTAGAAATGGCGAGATATCCTTTCAGAAACGTTTCTATCGAGGTTAAAACCATACCGGGTAA
GCCTGGCTGGTATTCATGCAAAATAAATGTAATTCCCCACATTCAATTTGAAGGAATGAATACTACAATG
ACTATAGATACTAGGCTTGAACCAGAATTATTCGGTACAAATAATAACTAA