SecReT6
Protein ID: 134301599
SecReT6 ID473
T6SS typeii
Gene symboliglC2
Locus tagFTW_0537
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]525855..526490 [+]
Productintracellular growth locus iglC
NoteIglC
UniProt IDA4IVU2
KEGG IDftw:FTW_0040, ftw:FTW_0537
PDB IDNA
Domain hit(s) vs Pfam IglC [PF11550], Evalue: 3.90E-143, Aligned region: 1..211
Protein Sequence: 211 a.a.     [Download]
>gi|134301599|ref|YP_001121567.1| intracellular growth locus iglC [Francisella tularensis subsp. tularensis WY96-3418]
MIMSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIEGGEDVTKADSATAA
ASVIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIM
IDLSNLELYPISAKAFSISIEPTELMGVSKDGMSYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAA
A
 
Nucleotide Sequence: 636 bp     [Download]
>gi|134301169|ref|NC_009257.1|:525855-526490 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGATTATGAGTGAGATGATAACAAGACAACAGGTAACAAGTGGCGAGACCATTCATGTGAGAACTGATC
CTACTGCATGTATAGGATCTCATCCTAATTGTAGATTATTTATTGATTCTTTAACTATAGCTGGGGAGAA
ACTTGATAAAAATATCGTTGCTATAGAGGGTGGAGAGGATGTCACGAAAGCTGATTCGGCTACAGCTGCT
GCTAGTGTAATACGTTTATCTATAACGCCAGGCTCTATAAATCCAACAATAAGTATTACTCTTGGTGTTC
TAATTAAATCAAATGTTAGAACTAAAATTGAAGAGAAAGTTTCGAGTATATTACAAGCAAGTGCTACAGA
TATGAAAATTAAGTTAGGTAATTCTAATAAAAAACAAGAGTATAAAACTGATGAAGCATGGGGTATTATG
ATAGATCTATCTAATTTAGAGTTATATCCAATAAGTGCTAAGGCTTTTAGTATTAGTATAGAGCCAACAG
AACTTATGGGTGTTTCAAAAGATGGAATGAGTTATCATATTATATCTATAGATGGTCTTACAACATCTCA
AGGAAGCTTGCCAGTATGTTGCGCAGCTAGCACAGATAAAGGAGTTGCTAAAATAGGATATATTGCAGCT
GCATAG