SecReT6
Protein ID: 134301602
SecReT6 ID473
T6SS typeii
Gene symbolpdpC2
Locus tagFTW_0540
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]528307..532293 [-]
Productpathogenicity determinant protein pdpC2
NotePdpC
UniProt IDA4IVU5
KEGG IDftw:FTW_0043, ftw:FTW_0540
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1328 a.a.     [Download]
>gi|134301602|ref|YP_001121570.1| pathogenicity determinant protein pdpC2 [Francisella tularensis subsp. tularensis WY96-3418]
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLAYMRRLRSIHPSKIAMQ
KIKSIRNKKNSFIIAILSLDKIIHKTKFITFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPS
ITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRELVAKIPDPYWVRADTKENKINITSEKKNLEK
DLKKITKLKNFEISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLL
ENLMTFLDALIVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKKISNIIWLGET
FHGLDIEEAQALCEFLDEENINPKINPINSKKLYKTYKENYKSDSEKILSFTKYKEKYNFLNNDKLREEH
ANKLSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFADIRNKLFI
VCYLPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYNSKQKYIKDFIDLDIIKLLKQTSSQIKPSY
IPVAFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGMSLFS
LNLTNEKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDIVIDEDQVLYMTYLYC
IFMAHSVDHTVDEILMSSNTYMLNSKEEKYPIANIANFFARPVFKLSKDKEFKALVEKYENSIKPNSKVL
KENYISRVTTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERNCTLLEQYSRKKKAETGLVQDGEKIKV
VNNYNSYAAINQYQRFVSLGIMYDSGAKYSSSHKKQIEKDFNLYSPDKEQINYLKYNFKDNKFDAVYKNK
KSKEKTQSHIVYAKKQNTRYCYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRV
SPELLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNIDTQ
EAANTFIDALYYIRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKIALNRASKPVIERF
LIILNIYNNTIDDNTLILIRCRLTIILFEHEEQKLKLKALQKYADAYKKNNYKNEINFRAWFESIFHVQN
LSLSPNYIGNNILILSLVEELKTKCSEYKKNMINQQIIAKANELNFYQLLIRLIEISTYHRILTKSIITN
TTSLLYDILNKPEFQTINKLINKLFIYKNKDLNTDKYKAFHTKLITIEKTYKKINSLYKSDFFKKISS
 
Nucleotide Sequence: 3987 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c532293-528307 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGAACGACAAATATGAACTAAATATCTATTTTGAGAAAATAGAGTTACCTAAAACAGCAGATTTCAATA
TGATAAGTAAGCATGATATTAAAGAACTCAGAGTAGATGCTAATTTAAAAAAGAAAATACACTTATTACA
ATTTGATGAAGATTATTTAGCATATATGAGGAGATTAAGATCTATTCATCCCTCAAAAATAGCGATGCAA
AAAATTAAATCAATTCGCAATAAAAAAAATTCTTTTATAATTGCCATTTTATCTTTAGATAAAATAATTC
ACAAAACTAAATTTATCACTTTTGGACATAAAACCGTTATTTTTGATTTTAAGAAACTATGGGGATTAGT
TGATTTCGTAATAGTTCATACAAGTAATAAAACCTGGGTTAATCATAAGTTAACATCATTTATGCCATCA
ATTACATACTGTAATCAAAACATCATCCATTTAGCATACCATTCTGATTTTTTATATATTTATCATACTC
CAGAATTTATGGATGATATAAATGTAGATCGAGAAAATAGAAGAGAGTTAGTGGCAAAAATTCCCGATCC
ATATTGGGTAAGAGCTGATACTAAAGAAAATAAAATCAATATTACTTCTGAAAAGAAAAATCTAGAAAAA
GATTTAAAAAAAATAACTAAATTAAAAAATTTTGAAATAAGCGCAAATGATATTTTTTTCTCAAAAGCTA
TAAAAGCAGCTCCAAGATTACAACATAAAAATAAGAGTAAATTATTTAATTCATTAGCGATTGAAAATAA
TGAAAAAATCAAACGTGACATAATTGATTATGCAATATCTAATGCTTGGTATAAAAACGAGGGGTTACTT
GAAAATCTAATGACATTTTTAGACGCGCTAATCGTAAGACATCTCTACTTAATAGCAGTTTACTCAGTTT
ATGAAATAGAAATAGGTATTAAATCAGTAAAACCTGAGTATAGCAAATTATTAAAAGCTGGCCTATTGAA
CAAAGATATTCAAAATCAATTGATATATGATCAAAAGAAAATTAGCAATATTATTTGGCTTGGTGAAACA
TTTCATGGTTTAGATATTGAAGAAGCTCAGGCTTTATGTGAGTTTCTTGATGAAGAGAATATTAACCCGA
AAATTAATCCTATAAATTCTAAAAAGCTATATAAAACCTACAAAGAAAATTATAAAAGCGATTCAGAAAA
AATTTTAAGTTTCACAAAATACAAAGAGAAATATAATTTTTTAAATAATGATAAGCTTAGAGAAGAACAT
GCAAATAAACTTTCAAGCATATTAGAAGATCCAAAATTTAGAGTTCTTAGCTATATAAATGCATTTTTAT
GTTCAACTAAAAATTATCTAGTACCTTATGGGTATTTAGGAAGTAATCCTCTTACATACTATAATTGTAT
GCTAGAAACCGGAAAACGTAGAACATCAAAAGAAGCATATTTTGCTGATATAAGAAACAAATTGTTTATA
GTATGCTATCTTCCTGGCTTCTTGAGCTCTGTAATTGCTGATGATGACTTTATAGACTGGTATTCTAATA
AGAAAGAAAATCAAGAATTACTCAAAAACTCTTATTTGAACAATTTATATAACTCAAAGCAGAAATATAT
AAAAGATTTTATCGATCTTGATATTATTAAACTTCTAAAACAGACATCATCTCAAATCAAGCCAAGCTAT
ATACCAGTAGCTTTTAGATATGGTGCATTTGCCTCAACAACTGCTTTGATAAGATCAAATGCAAATGTTT
CTAATCGAATGGAGTTTGAATTATATGACTCACCTGAAAGACTACATAATCAATACTCAGAAAAAGAGGA
AATGATTATGCCAAAATCGGTTAATAACCCCAAGGATCACTCAATTGACAATGGAATGTCTTTATTTAGC
CTTAATCTAACAAATGAAAAAGAAGATGGACTTCGAAAAGTTATGTTGAAAGTTGCACAACTATATAATC
TTGATTTCAAGGTAGGTATCTCAGGAAATTTAGATCAAGCAATGACTCAGGCATTAATACTCGGGATGGC
AACTACAAAAAAAAATGGAGATATCGTAATTGATGAAGATCAAGTGCTATATATGACATACTTATACTGC
ATTTTCATGGCACATAGTGTCGATCATACTGTAGATGAAATACTAATGTCCTCAAATACTTATATGTTAA
ACTCTAAAGAGGAAAAGTATCCTATAGCCAATATAGCTAATTTTTTTGCTAGACCTGTATTTAAACTTTC
TAAGGATAAAGAGTTTAAAGCATTAGTTGAAAAGTATGAAAATAGCATAAAACCTAATTCAAAAGTTCTC
AAAGAAAATTATATAAGTAGAGTAACGACGTTATCCGAGGTATATGAAGATATATATAATTTAAATTGCT
TATATAGTTCTCTATCAGAAGGATCCTTGTATAACCTATTATCAACTCATAGTGAAAGAAACTGTACTTT
ATTAGAGCAGTATTCTCGTAAGAAGAAAGCGGAGACAGGATTGGTCCAAGATGGAGAGAAAATAAAAGTC
GTAAACAACTACAATAGCTATGCTGCGATTAATCAATATCAACGTTTTGTATCACTAGGCATAATGTATG
ATAGTGGTGCAAAATACTCCTCTTCTCATAAAAAACAGATAGAAAAAGATTTCAACTTATACTCACCAGA
TAAAGAACAGATAAATTATCTAAAATATAACTTTAAAGATAATAAATTTGATGCTGTTTATAAAAACAAA
AAGAGCAAAGAAAAAACTCAAAGCCATATTGTGTATGCAAAAAAACAAAATACGCGATATTGCTACGGAT
ATTTTAACGATTTTTTCGTTAAAAATAGAATTACGACTTTTTATAAAATAAAAGATAAATCAGGAAACTA
TTTAGTAAACTTACATAATGAAAAATATAGTTTCGCAACACCTAATTCAGATTCTAAAATATATAGAGTT
TCACCAGAATTACTTAACAATAGAGATGATTTTAAAAGAGTATCTAAAGATATTATAAAATCATATAAAT
ATATTAGTTTTGATAAACAAAAGGAAGATATAGTTAAAAATTTTGGTAAAAACTTATATCATACTAATTA
TGAGATATGGGTCGGACTATCACATCAAGCTATATCATGTTTTTCAGTTTTAGATAACATAGATACACAA
GAAGCTGCTAATACTTTTATCGATGCTTTATATTATATTAGATTAATGCAATTATATTATGGCAAAACTA
TACCTTTTTTGTGGATTAGTAGCGAAATTGTAAGATATTCTTCATCAGAAACTCACTACTATATACCAAC
AGAAGAAAACTTTGAAAATATACTTAAAATTGCTCTTAATAGAGCCTCAAAACCAGTAATAGAAAGATTC
TTAATTATTCTTAACATATATAATAACACTATTGATGATAATACTTTAATTTTAATACGATGCCGTTTAA
CAATAATATTATTTGAACATGAAGAGCAGAAACTCAAATTAAAAGCTTTACAAAAATATGCTGACGCTTA
TAAAAAAAATAATTATAAAAACGAAATTAATTTTAGAGCTTGGTTTGAATCTATATTTCATGTTCAAAAC
TTATCCTTATCTCCTAATTATATTGGCAATAATATTTTAATCTTGAGTTTAGTTGAAGAATTAAAAACAA
AATGTAGTGAATATAAAAAAAACATGATTAACCAACAAATTATAGCTAAAGCAAACGAGTTAAACTTTTA
TCAACTTCTAATAAGACTTATTGAAATATCAACCTATCATAGAATACTTACGAAATCAATCATAACTAAT
ACAACCTCGTTACTTTATGACATATTAAATAAACCAGAATTTCAAACAATAAATAAATTAATAAATAAGC
TATTTATTTATAAAAACAAGGATCTAAATACTGATAAATATAAAGCCTTTCACACTAAGCTTATAACTAT
TGAAAAAACCTATAAGAAAATAAATAGCTTATATAAATCAGACTTTTTTAAAAAAATATCATCATAG