SecReT6
Protein ID: 134301605
SecReT6 ID473
T6SS typeii
Gene symbol-
Locus tagFTW_0543
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]534245..534868 [-]
Producthypothetical protein
NoteDotU
UniProt IDA4IVU8
KEGG IDftw:FTW_0046, ftw:FTW_0543
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-10, Aligned region: 28..205
Protein Sequence: 207 a.a.     [Download]
>gi|134301605|ref|YP_001121573.1| hypothetical protein FTW_0543 [Francisella tularensis subsp. tularensis WY96-3418]
MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVD
EKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPEICYQTISLILHNDFYGKYYDNI
YNHSFLAYKKEIDKHIENSTIDSVNFIDIPVNSPPLSRKYSKTLKFLLRIGVPLGLFLLSLLILLSW
 
Nucleotide Sequence: 624 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c534868-534245 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGAAAGACTTTAAAGAGATAGAAATTATTCTAGATATTATAAAAACTACAAGAGAAATTATAGAAGATA
ATGATAATGATAATGAGAAAATATCATACCATCGTAATAATATAAGAAAAAGTATTTTCTTCCTACAAGA
AGAGCTCTTAGAAAAATATAGTGAAACTGTCTGTAAATATATAGTTTTTCCGTTACTTGCATATGTTGAT
GAAAAATTGATGCTACTTAGGGAAAAGTCAGCAAGCAATATTTCTTGGAGTCTACTACAATTAGAATATT
ATGATAGAAAAGATGGCGGTGAATATGTTTTTGAGATAACTGATAATATTTTATCAGAGAATATCTATCC
AGAAATTTGCTACCAGACAATATCACTTATCCTACACAATGACTTCTATGGCAAATACTATGACAATATA
TATAACCATAGCTTTCTTGCTTATAAGAAAGAAATTGATAAGCATATAGAAAATTCGACAATTGATTCGG
TTAATTTTATTGATATACCCGTTAATAGCCCCCCACTGTCAAGAAAATATAGTAAGACGCTTAAATTCTT
ATTAAGAATAGGCGTTCCTTTAGGACTGTTTCTTTTAAGCTTACTAATTTTATTAAGCTGGTAA