SecReT6
Protein ID: 134301611
SecReT6 ID473
T6SS typeii
Gene symbolpdpB2
Locus tagFTW_0549
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]539455..542736 [-]
Productpathogenicity determinant protein pdpB2
NotePdpB
UniProt IDA4IVV4
KEGG IDftw:FTW_0549, ftw:FTW_0052
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 0.00056, Aligned region: 847..942
Protein Sequence: 1093 a.a.     [Download]
>gi|134301611|ref|YP_001121579.1| pathogenicity determinant protein pdpB2 [Francisella tularensis subsp. tularensis WY96-3418]
MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSASKTIKNAKSLIKKNKVKNNLSELYIF
YGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKNNTSLVFANNEFSYLYKLKKKLNLQFYKLNFCFDISD
DYYHENIKISEIYKELLKLRLKNFIISFYTLSEHTRSYNNAIDKKSIFKLTSDADTNHKAEEEILSKILS
SKDDVNNKYNNVKILNQIRRLLKNIHPQLKSINKETFFNFGLNTPDNIIAKKDTIFFSSSPKSIIINLIS
LLFSFIFIVNIFQEINIKEKFSIQELNQLHESDSNKIIEETRKKIDEAILLDILYPKSIKYHFIYEQYAD
TLLKNVILPKYNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSITNLSEKQLDIVINYTTPSIRT
EMIKSAINRANKLYTNRLIVVGEDSESYLSTKGFNAEYLGISNTKRAKVINNIYIQYLYKCATDNAILDL
NDNYIIPIEVNNIFKMYQEQFDTSSKKLCNSSYINSITKSVSLILNQEENKRKFESFSDMLDHIYYLVKS
LEKNAKDVADDGKKQTSSITVSLINYVINSVVNPTYNKNELPLISPVSKNLYMEFAPNFYSKRILISPIY
SKEYIKDNIDPTNKKFNRLVNNLKNNFNIEPDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDSEFNKNI
SNKGALKLYLLAMSSKDSSFNSLIEFYSTNTDLITNESETNSSKKINKLQHFYGEITKLNKQNNTNDQND
KSLWAPIDNYFKENDKYLESKSYADYKNIFKQLNNLIIEQGYSSTYKNIKQGYEPLQKVYSELSKINNHQ
GNNNLYKLLKKHLDIAINTIKTIAIQDAITKLDNTVNIEYEYINNQFPFNKDSNSAATNEAITKDFDNNG
YIYSGFIEQLSPLLSYNKTDDRWESKDFSKPEEIDYLNKFNKVYLLNKLLWDDKRNPKAIKFDITPIPNK
DNDYTFFSIILDKQNYVNSLNIKYSDSIEVLYNWNSLESTTITIKFEDGSNEQISYQGKWSILKAIKDAN
CDQNNICTWVIKHKGKKYPLSFKIESKFLQVLGWQKQGEVNVQ
 
Nucleotide Sequence: 3282 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c542736-539455 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGAATTTTATTAAAAATCATCAAATATTAATAATTTCACTAACTATAGCAATAATTGTTTTATCAGTAC
TTGGTATTTTTATGATTAAAAAATGGCTTAAAACATCAAGAAATCCTAACAAAAAATCTGCCTCAAAGAC
CATAAAAAATGCAAAATCATTGATCAAAAAGAATAAAGTAAAAAACAACTTAAGTGAATTGTATATTTTC
TATGGGGACTATCTGGCAGCTAAAGATTATATAACAAAGATAAAACCTCAAGCTCAAATCATTGATAATA
ATGAACTCCCTTTAATAGCTATTGATAAAAACAATACATCTCTCGTATTTGCAAATAATGAATTTTCGTA
CCTATATAAGTTAAAAAAGAAACTAAATCTACAATTTTATAAGCTTAACTTTTGCTTCGATATATCCGAT
GATTACTACCATGAAAATATCAAAATTAGTGAAATCTATAAAGAACTATTAAAATTAAGATTAAAAAACT
TCATAATATCTTTTTACACCTTATCTGAGCATACTAGAAGCTATAATAATGCAATTGATAAAAAATCAAT
ATTTAAATTAACTTCTGATGCGGATACAAATCATAAAGCTGAAGAGGAAATATTATCAAAAATTCTTAGC
TCTAAAGATGATGTTAATAATAAATACAATAATGTTAAGATATTAAATCAAATAAGAAGGTTGCTAAAAA
ACATCCACCCTCAATTAAAATCTATAAATAAAGAAACATTCTTTAATTTTGGGCTAAACACACCAGATAA
TATCATAGCAAAGAAAGATACAATATTTTTTAGCAGCTCTCCAAAAAGTATTATCATAAACTTAATATCT
TTGTTATTTAGTTTTATATTTATCGTTAATATTTTTCAAGAAATTAACATTAAAGAAAAATTCTCTATAC
AAGAGCTTAATCAACTACATGAAAGCGACTCTAATAAAATAATAGAAGAAACTAGAAAAAAAATTGATGA
GGCTATACTTCTAGATATCCTATATCCGAAATCGATAAAATATCATTTCATATACGAACAATATGCTGAT
ACTCTCCTAAAGAATGTAATCTTACCAAAATATAATGATACATATGACTTATCAATGATTACATCATTTT
TAATATTTTTTGAGTATTTGGATAACAAAATTATTAACCAACATACGAATAGAATACTTAAAATAATAAG
CAGTATCACCAACCTATCTGAAAAGCAGCTAGATATCGTGATCAATTATACGACCCCAAGTATAAGAACT
GAAATGATTAAGTCAGCCATCAACAGAGCAAATAAACTTTATACAAATCGTTTAATAGTTGTAGGTGAAG
ACTCCGAAAGTTACTTAAGTACTAAAGGATTTAATGCTGAATACTTAGGGATTTCAAATACTAAAAGAGC
GAAGGTCATAAATAATATTTATATACAATACCTATATAAATGTGCTACAGATAATGCAATTTTAGATTTA
AACGATAACTACATAATACCAATAGAAGTAAATAATATCTTCAAGATGTATCAAGAGCAATTTGACACAT
CCTCTAAAAAGCTATGTAACTCATCATATATTAACTCTATTACAAAGAGCGTTTCTTTGATACTTAATCA
AGAGGAAAATAAAAGAAAATTTGAAAGCTTCAGTGATATGCTAGACCATATCTATTATTTAGTAAAATCA
TTAGAAAAAAATGCTAAAGATGTCGCAGATGATGGTAAAAAACAAACTAGCTCGATAACAGTATCGCTTA
TAAATTACGTTATAAATAGTGTTGTCAACCCTACTTATAATAAAAATGAGCTCCCACTAATAAGTCCAGT
AAGTAAAAACCTATATATGGAGTTTGCTCCTAATTTCTATAGTAAAAGAATACTTATCTCTCCAATATAC
TCAAAAGAATATATTAAAGATAATATAGATCCTACAAATAAAAAGTTTAATAGACTCGTCAATAATCTAA
AGAATAACTTCAATATAGAACCCGACTTTATGATTGCTATCTATAAAAGTTCTATAAATAACTACATTGA
GAAATATATAGGATCCTATAATAAGATGATTGATAGCCTTAATAATGACTCTGAATTTAACAAAAATATA
TCTAACAAGGGTGCTCTTAAATTATATTTGCTAGCAATGTCATCAAAGGATTCTTCCTTTAATAGCCTAA
TAGAGTTTTATAGCACTAATACAGACCTAATAACTAATGAATCCGAAACCAATTCATCTAAAAAGATAAA
TAAGCTTCAACATTTTTATGGAGAAATAACTAAATTAAACAAACAAAACAATACTAATGATCAAAATGAT
AAGTCATTGTGGGCGCCTATAGATAACTACTTTAAAGAAAACGATAAATATCTTGAGTCTAAGAGTTATG
CCGACTATAAAAACATATTTAAACAGTTAAATAATCTAATAATAGAACAAGGCTATTCAAGTACATATAA
AAATATCAAACAAGGATATGAACCACTACAAAAAGTTTACTCTGAACTTTCTAAGATAAATAATCATCAA
GGTAATAATAACTTATATAAACTGTTGAAGAAACATCTAGATATTGCCATTAATACTATAAAAACTATCG
CCATACAAGATGCTATAACTAAACTTGATAATACTGTCAATATTGAGTACGAATACATAAATAATCAATT
CCCTTTTAATAAGGATAGTAACTCGGCTGCAACAAATGAAGCTATAACCAAAGACTTTGATAACAATGGT
TATATATACTCTGGATTTATAGAGCAACTATCTCCACTACTTTCTTATAATAAAACTGATGATAGATGGG
AAAGTAAAGATTTTTCAAAACCTGAGGAAATAGACTATCTAAATAAATTCAATAAGGTATATCTTTTAAA
TAAGCTACTATGGGATGATAAAAGAAATCCAAAAGCTATAAAATTTGATATAACTCCTATACCAAACAAA
GATAATGATTATACATTTTTTAGCATAATCCTCGATAAGCAAAACTATGTAAACTCATTAAACATAAAAT
ATTCAGATAGTATTGAAGTTTTGTACAACTGGAATTCACTTGAGTCAACAACTATTACCATAAAATTTGA
GGATGGTAGTAATGAGCAAATAAGCTATCAAGGAAAATGGTCTATATTAAAAGCAATTAAAGACGCAAAT
TGTGATCAAAACAATATTTGTACCTGGGTAATCAAGCACAAAGGTAAAAAATATCCTTTAAGCTTCAAAA
TAGAATCAAAATTCTTACAAGTATTAGGATGGCAAAAACAAGGAGAAGTCAATGTACAATAA