SecReT6
Protein ID: 134301612
SecReT6 ID473
T6SS typeii
Gene symbolpdpA2
Locus tagFTW_0550
StrainFrancisella tularensis subsp. tularensis WY96-3418
Repliconchromosome [GenBank: NC_009257] [Browse all T6SS(s) in this replicon]
Location [Strand]542741..545203 [-]
Productpathogenicity determinant protein, pdpA
NotePdpA
UniProt IDA4IVV5
KEGG IDftw:FTW_0053, ftw:FTW_0550
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 820 a.a.     [Download]
>gi|134301612|ref|YP_001121580.1| pathogenicity determinant protein, pdpA [Francisella tularensis subsp. tularensis WY96-3418]
MIAVKDITDLNIQDIISQLTSEVINGDTTSSSAKFACEINSYIINYKLLNINLINTQLKNTKILYRKGLI
SKLDYEKYKRYCVICRLKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLT
SIDSAIQRSSDLNKTIIKQLNKLKSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFK
HNSLTLKNPHIEKLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKD
HHKRTTRFMAIGFNSNSIDIHENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPSYIALNKSLDD
IFKENFFFDNLVSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNKCYLKYFCDKKSGKVSYHVVD
QVDNDLQRNIVNSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLNTQKKEDRKISDTLIK
PFSSILKDNLQSIEYIQSNNDDIQEIITTGFEILLTSRNTLPFLDTEITLSKLDNDQNYLLGATDIKSLY
ISQRKLLFKRSKYCSKQLYENLHNFHYKSDSESDVYEKIAFTKYPSLTHDNLITYKIKDYSNLTPEYPKY
KSFSNFYINGRVTIGENVNNDSKKAYKFFKNYKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEM
LSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEMQSFTKGEIIELISNSAISTKKAQQQLLQRQL
LGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIFLRYKSKGN
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|134301169|ref|NC_009257.1|:c545203-542741 Francisella tularensis subsp. tularensis WY96-3418 chromosome, complete genome
ATGATAGCAGTAAAAGATATAACTGATTTAAATATACAAGACATAATTAGTCAGTTAACTTCTGAAGTTA
TAAATGGCGACACAACCTCTTCTTCTGCCAAGTTTGCTTGTGAAATTAATAGCTATATTATTAATTACAA
ACTATTAAACATTAATCTTATTAATACTCAACTAAAAAATACAAAGATACTTTATAGAAAAGGCTTGATA
TCTAAGCTTGATTACGAAAAATATAAAAGATATTGCGTAATATGTAGATTAAAAAATAACATAGATGAAT
TTATCTTATATTTTTCGACAAACTATAAAGACTCTCAAAGCTTAAAAATCGCAATTAAAGAATTACAAAA
CTCATGCTCATCAAGTTTAATTCTTGAGCTCCCTCATGATTACATAAGAAAAATTGATGTCTTACTAACT
AGTATAGATAGTGCGATACAAAGATCAAGTGATCTCAACAAAACAATTATAAAACAGTTAAATAAGCTTA
AAAGCAGCCTTTCACGATATATTGGGTATAATAATGTACTGCAAAAACAAGAAATTACTATAAATATAAA
GCCTATTAATAAAAATTTTGAACTTGAGGATATAAGTTTTGTATCAACTAGAAATAAGCAATATTTTAAG
CATAACTCTCTTACACTTAAAAACCCTCATATTGAAAAATTAGAAGTATGTGAAAATATCTACGGCATAA
ATGGCTGGTTAACTTTTGATTTAGCATATATCAATAATCACAAAGACTTTAACTTCCTATTAAGCCCAAA
TCAACCCATATTACTTGATATTCAAATTAATGATAGCTTCAATTTTTACAAAAAAGAATCTAAAAAAGAT
CATCATAAGAGAACAACCCGTTTTATGGCCATTGGCTTTAATTCAAACAGTATAGATATTCATGAGAACT
TTGAATACAGCATATATTCTTATACCAAAAATGTTTCTTCAGGAGTAAAAAAATTTAAAATACAATTCCA
TGACCCACTAAAAGCACTTTGGACTAAGCACAAACCATCTTATATAGCTTTAAATAAAAGCTTAGATGAT
ATCTTTAAAGAGAATTTTTTCTTTGATAATTTAGTTTCTTTAGATACCAACAAAAGTAATAACCTAAAAA
TACGTATACCACAAGCATTTATTTCTACAGTTAATCGAAATTTTTATGATTTTTTTATTCAACAACTTGA
GCAAAATAAATGCTATTTAAAATATTTCTGTGATAAGAAGAGTGGCAAAGTAAGCTATCATGTTGTAGAT
CAAGTAGATAATGACTTACAAAGGAATATCGTAAATTCAGATGAAGATTTAAAAGACAAACTATCTCCTT
ATGATATAAGCTGCTTCAAAAAACAAATTCTAATCTCAAATAAATCAAACTTTTATGTTAAAGAAAAAAA
TATATGTCCTGATGTGACTTTAAACACTCAAAAAAAGGAAGATCGAAAGATTTCAGATACCTTAATAAAG
CCATTCTCATCCATACTCAAGGATAACTTACAATCTATAGAGTATATACAAAGCAATAATGATGATATAC
AAGAAATTATTACTACAGGATTTGAGATATTACTGACATCAAGAAATACTCTGCCCTTCTTAGATACTGA
AATTACTCTTTCTAAACTAGACAATGATCAAAACTATCTTTTAGGCGCAACAGATATAAAAAGCTTATAT
ATAAGTCAAAGAAAGCTATTATTTAAAAGAAGTAAATACTGCTCTAAACAACTATATGAAAACTTACATA
ATTTTCACTATAAAAGTGATTCTGAATCAGACGTATATGAAAAAATTGCTTTTACTAAATACCCTAGTCT
GACACATGACAACTTAATAACTTATAAAATTAAGGATTATAGTAATCTAACTCCTGAATATCCTAAGTAC
AAAAGTTTTAGTAACTTTTATATTAATGGTAGAGTAACGATTGGAGAAAATGTTAATAATGACTCCAAAA
AAGCTTATAAATTCTTTAAAAATTATAAGCCAGAAGAAAGCTCAATCGCAGAATTTCAAGAAAATGGTGA
AAAAGGTACTTCAGCTATACTAAATAGTAAGGCTGATATCTTATACGCAATAGAAATTGCCAAGGAAATG
TTATCTGATAAATCATCAGATAAGCCAATCATATACTTACCTCTAAAAGTAAACATAAATTCTGCTAATA
ATCAATTTATACCATTGAGAAATGACGATATTATCTTAATTGAAATGCAGTCTTTTACTAAAGGTGAAAT
TATTGAGTTAATTTCGAACTCTGCCATATCAACAAAGAAAGCTCAGCAGCAACTACTACAACGACAACTT
CTTGGATCTAAAGAAAACTGTGAAATGGCATATACCCAAACAAGTGATAGCGAGACATTCTCACTAACTC
AAGTAAATGAAGATTGTGAGAATTCTTTTTTGATAAATGATAAAAAAGGTATTTTTCTAAGATATAAATC
AAAAGGAAATTAA