SecReT6
Protein ID: 13472136
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmll2335
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1882260..1885097 [-]
ProductClpA/B-type protease
NoteTssH
UniProt IDQ98IM7
KEGG IDmlo:mll2335
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 231..287
AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 677..842
AAA [PF00004], Evalue: 3.10E-20, Aligned region: 231..363
AAA [PF00004], Evalue: 3.10E-20, Aligned region: 683..767
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 231..255
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 682..799
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 208..253
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 276..309
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 464..502
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 650..727
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 746..764
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 842..876
ClpB_D2-small [PF10431], Evalue: 9.00E-11, Aligned region: 850..925
AAA_22 [PF13401], Evalue: 3.60E-09, Aligned region: 230..312
AAA_22 [PF13401], Evalue: 3.60E-09, Aligned region: 342..391
AAA_22 [PF13401], Evalue: 3.60E-09, Aligned region: 681..715
AAA_25 [PF13481], Evalue: 5.00E-07, Aligned region: 213..308
AAA_25 [PF13481], Evalue: 5.00E-07, Aligned region: 680..707
AAA_25 [PF13481], Evalue: 5.00E-07, Aligned region: 859..904
Sigma54_activat [PF00158], Evalue: 9.50E-07, Aligned region: 210..245
Sigma54_activat [PF00158], Evalue: 9.50E-07, Aligned region: 682..782
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 231..253
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 679..704
IstB_IS21 [PF01695], Evalue: 2.50E-05, Aligned region: 224..252
IstB_IS21 [PF01695], Evalue: 2.50E-05, Aligned region: 682..701
IstB_IS21 [PF01695], Evalue: 2.50E-05, Aligned region: 848..882
AAA_14 [PF13173], Evalue: 3.00E-05, Aligned region: 231..311
AAA_14 [PF13173], Evalue: 3.00E-05, Aligned region: 681..763
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 231..252
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 675..722
NACHT [PF05729], Evalue: 0.00012, Aligned region: 231..259
NACHT [PF05729], Evalue: 0.00012, Aligned region: 682..709
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 231..255
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 681..717
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 210..248
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 283..315
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 679..703
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 749..764
AAA_29 [PF13555], Evalue: 0.00096, Aligned region: 223..246
AAA_29 [PF13555], Evalue: 0.00096, Aligned region: 680..707
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 231..247
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 683..713
RNA_helicase [PF00910], Evalue: 0.0076, Aligned region: 232..253
RNA_helicase [PF00910], Evalue: 0.0076, Aligned region: 683..704
RNA_helicase [PF00910], Evalue: 0.0076, Aligned region: 780..801
Protein Sequence: 945 a.a.     [Download]
>gi|13472136|ref|NP_103703.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MEQRRSSQSFKRKELVAKLNPTGLRAFKAAADTAKMRGNPYVELVHFVQQLVLSERSDVQMIVADAGLDV
SRLTADMTRAIDKLPYGATSVEEFSDHIFHAIQEGWSLATLEFGVEEVRSAHILLACLKTPALEGLVSKI
SAEFDKIDADGVIARFADVTEGSLEAGSPPAAAAAETPMKRGLGGDSALAKYATDLTQRARDGKIDPVIG
RDPEIRQIVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIAQGDVPPTLQNVSVRMLDVGLMQAGASVK
GEFEKRLKAVIDEVQASETPIILFIDEAHTLIGAGGAAGTGDAANLLKPALARGELRTIAATTWAEYKQH
IEKDPALTRRFQVVKIEEPSETVAVLMLRGVAGVLEQHHKVQILDEAIEASVSLSHRYIPARQLPDKAVS
LLDTACARVAVSQHATPAEVEDILRRRQALEVEEGIIGREAAIGIEVVDRQARVEAGLAETETTLAAAQA
RWDREKALVAEILDLRAKLRGEGVPLDAVEGGEAAPGEAVDAPAATSHERKAPEAKTPKPETAEPKGSKS
KSAKTKAAKMEAVAAHEPVPVPDSAADLARLRELMAELAEAQGETPLILPSVDRNAVAAVVQDWTGIPTG
RMLSSQTEKALKLAATLAERVVGQDHAMEMIARRVQTSRAGLGAPEKPVGVFLLCGPSGVGKTETALALA
ETLYGGEQNLISINMSEFQEAHTVSTLKGAPPGYVGYGKGGILTEAVRRKPYSVILLDEVEKAHPDVHEI
FFQVFDKGMMDDSEGRRIDFKNTLILLTSNVGSEVIMDRTKNGTLRTGMDDLDTALRGPLLKVFPAAFLG
RVVTIPYYPLSDAMIEAITRHQFGKIARRLKATNDAELVIGDGVMDMVKARCTEIESGGRMIDAILTNTL
LPELSRGVLNRSLEGKKMTKVTVGASSEGFTYSFE
 
Nucleotide Sequence: 2838 bp     [Download]
>gi|57165207|ref|NC_002678.2|:c1885097-1882260 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGGAACAGCGCCGATCGTCGCAGAGTTTCAAGCGCAAGGAACTGGTTGCAAAGCTCAATCCCACGGGGT
TGCGCGCCTTCAAGGCTGCCGCGGACACGGCGAAGATGCGCGGCAACCCCTATGTCGAGCTCGTCCATTT
CGTCCAGCAACTGGTGCTGTCCGAGCGTTCGGATGTGCAGATGATCGTTGCCGATGCCGGGCTGGATGTC
AGCCGGCTGACGGCCGATATGACCCGCGCCATCGACAAGCTTCCCTACGGCGCGACCTCGGTGGAGGAAT
TCTCCGATCACATCTTCCACGCCATACAGGAAGGCTGGAGCCTGGCCACACTGGAATTCGGTGTCGAGGA
GGTGCGCAGCGCGCATATTCTTCTCGCCTGTCTGAAGACACCGGCGCTGGAAGGGCTGGTTTCGAAAATC
AGCGCCGAATTCGACAAGATCGATGCGGACGGGGTCATAGCCCGCTTCGCCGACGTCACTGAGGGCTCGC
TCGAAGCCGGTTCACCTCCGGCCGCAGCTGCGGCCGAAACACCGATGAAACGCGGTTTGGGCGGGGATTC
GGCACTCGCCAAATACGCCACCGACCTGACCCAGCGTGCCCGCGACGGCAAGATCGATCCGGTTATCGGC
CGCGATCCCGAAATCCGCCAGATTGTCGATATCCTGATGCGGCGCCGGCAAAACAACCCGATCCTGACCG
GCGAGGCAGGTGTCGGCAAGACGGCGGTCGTCGAGGGCTTTGCCTTGCGCATCGCCCAGGGCGACGTGCC
GCCGACGCTTCAAAATGTCAGCGTACGCATGCTCGATGTCGGGCTGATGCAGGCGGGCGCCAGCGTCAAG
GGCGAGTTCGAAAAGCGGCTGAAGGCCGTCATCGACGAGGTCCAGGCCTCGGAGACGCCGATCATCCTCT
TCATCGACGAGGCGCACACGCTGATCGGTGCCGGCGGCGCGGCGGGAACCGGCGATGCGGCCAATCTCCT
CAAGCCCGCGCTCGCGCGCGGCGAGCTTCGCACCATCGCCGCCACGACCTGGGCCGAATACAAGCAACAT
ATCGAGAAGGATCCGGCGCTGACCCGTCGGTTCCAGGTGGTCAAGATCGAAGAGCCTTCCGAAACGGTGG
CCGTGCTGATGTTGCGCGGTGTCGCCGGTGTTCTCGAGCAGCACCACAAGGTACAGATCCTCGACGAGGC
GATCGAGGCCTCGGTTTCGCTTTCGCACCGCTACATTCCGGCCAGACAGCTGCCCGACAAGGCGGTCAGC
CTCCTCGACACAGCCTGCGCCCGCGTTGCCGTCTCGCAGCACGCTACGCCGGCGGAGGTCGAGGACATTC
TGCGGCGCCGCCAGGCGCTCGAGGTCGAGGAAGGCATCATCGGCCGCGAGGCGGCGATCGGCATCGAAGT
GGTCGACAGACAGGCTCGCGTGGAGGCCGGGTTGGCGGAAACCGAGACCACGCTTGCGGCAGCGCAAGCA
CGCTGGGATCGGGAAAAGGCGCTGGTCGCCGAGATTCTCGATCTGCGCGCCAAACTCCGGGGCGAGGGCG
TGCCGCTTGACGCGGTGGAGGGCGGGGAAGCCGCTCCGGGCGAGGCCGTCGATGCGCCAGCTGCCACGTC
GCATGAAAGGAAGGCGCCTGAGGCCAAAACGCCGAAACCCGAGACGGCTGAACCCAAGGGCTCGAAGAGC
AAGTCCGCGAAAACAAAGGCGGCAAAGATGGAGGCCGTTGCTGCGCACGAGCCTGTTCCTGTGCCGGATT
CCGCTGCAGATCTGGCTCGACTGCGCGAATTGATGGCGGAACTTGCCGAGGCGCAGGGCGAGACCCCGCT
GATCCTGCCGTCGGTCGATCGCAATGCCGTGGCGGCCGTTGTCCAGGACTGGACCGGCATTCCGACGGGA
CGGATGCTGTCCAGCCAGACCGAGAAGGCGCTCAAGCTCGCCGCCACCTTGGCTGAGCGCGTTGTGGGTC
AGGACCATGCGATGGAGATGATCGCGAGACGTGTGCAGACCAGCCGCGCCGGCCTCGGCGCGCCGGAGAA
GCCGGTCGGCGTGTTCCTGCTTTGCGGCCCCTCGGGCGTCGGCAAGACCGAGACAGCCCTGGCGCTGGCC
GAAACGCTTTATGGCGGCGAGCAGAACCTGATTTCGATCAACATGTCCGAATTCCAGGAGGCGCACACGG
TCTCGACGCTGAAGGGCGCGCCGCCCGGTTATGTCGGTTATGGCAAGGGCGGCATCCTGACCGAGGCCGT
GCGGCGCAAGCCCTATTCGGTGATCCTGCTCGACGAGGTCGAGAAGGCGCATCCGGACGTACACGAGATC
TTCTTCCAGGTCTTCGACAAGGGGATGATGGACGACAGCGAAGGCCGCCGGATCGACTTCAAGAACACTC
TGATCCTGCTCACCTCGAATGTCGGCTCCGAGGTTATCATGGACCGCACGAAGAACGGCACCTTGCGCAC
CGGCATGGACGATCTGGACACCGCCTTGCGCGGCCCGCTGCTGAAAGTGTTTCCGGCCGCTTTCCTCGGC
CGCGTGGTGACGATCCCTTACTATCCGCTCTCGGACGCGATGATCGAGGCGATCACCAGGCACCAGTTCG
GCAAGATCGCGCGCCGCCTCAAGGCAACCAACGATGCCGAGCTGGTGATCGGCGACGGTGTCATGGACAT
GGTCAAGGCGCGCTGCACCGAGATCGAATCCGGCGGACGCATGATCGACGCGATCCTCACCAACACGCTG
CTGCCGGAACTCAGCCGCGGCGTGCTCAATCGCTCGCTGGAGGGCAAGAAGATGACAAAAGTCACCGTCG
GCGCCTCGTCGGAAGGATTTACCTACTCCTTCGAATAG