SecReT6
Protein ID: 13472137
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2336
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1885421..1886596 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ98IM6
KEGG IDmlo:mlr2336
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.40E-20, Aligned region: 56..115
Protein Sequence: 391 a.a.     [Download]
>gi|13472137|ref|NP_103704.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MIDLALWLNPLNGANPSGEDLRNDPAFHELERLTEAQLKVVHDGGNKASQSTSSVDWAAVLEKSEELQSR
GRDLRLLVIVTRALANEEKLAGLTQGLTLIARTFEQYWDTMHPALRTGATPRDAALRRINALLDLQNGQE
GLLGNLRQTVFFSPRAIGPISGRDLEQAALDERVMLQEAASGLGTAEKAALTAAHNQLLNRVRTGCAAQI
DQAADTVTTLLADARAAISALEAVDTALNARIDGNGAAVPDLKKFLQRLLTTLERNSSAGAMVNGATRPA
PQPAQPASTPTQNGHGAETMASVASSVEPSAGLPDRINSRDDVVKCLDLVVAFYDRTEPSSPIPHLARRV
RRMVHMDFVELMEDLAPSGLKEFRLLAGVADPKKPAQKDER
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1885421-1886596 Mesorhizobium loti MAFF303099 chromosome, complete genome
GTGATTGATCTCGCACTCTGGCTGAATCCTCTGAACGGTGCGAACCCGTCGGGAGAGGATTTACGCAACG
ACCCGGCCTTTCACGAGCTGGAGCGGCTCACGGAAGCCCAGCTCAAGGTCGTCCATGACGGTGGCAACAA
GGCTTCGCAATCAACCAGCTCCGTCGACTGGGCCGCCGTCCTCGAAAAATCGGAAGAATTGCAGTCGCGC
GGCCGGGATTTGCGCCTTCTGGTCATCGTCACGCGCGCGCTGGCCAATGAAGAGAAGCTCGCCGGCCTCA
CCCAGGGGCTGACCTTGATCGCAAGGACTTTCGAGCAGTACTGGGATACGATGCATCCGGCTTTGCGGAC
GGGTGCCACACCCCGCGACGCGGCGCTGCGACGCATCAATGCGCTGCTTGACCTCCAGAACGGCCAGGAA
GGCCTGCTGGGGAACCTCAGGCAGACCGTCTTCTTCTCACCGCGCGCCATTGGGCCGATCAGCGGGCGAG
ACCTGGAACAGGCAGCGCTCGACGAGCGCGTCATGCTCCAGGAAGCAGCCTCGGGCCTCGGAACGGCCGA
AAAGGCGGCGCTGACGGCCGCCCACAACCAACTGCTGAATCGGGTGCGCACGGGATGCGCGGCGCAGATC
GATCAGGCCGCGGACACTGTCACGACACTTTTGGCCGATGCGCGCGCCGCGATTTCGGCGCTGGAGGCGG
TGGATACCGCGCTCAATGCCCGCATCGACGGCAATGGCGCGGCCGTTCCGGATCTGAAGAAGTTCCTGCA
GCGCCTGCTGACGACGCTGGAGCGGAATTCCAGCGCCGGCGCCATGGTCAACGGTGCGACGAGGCCCGCC
CCGCAGCCGGCTCAACCGGCATCGACGCCCACCCAAAACGGTCATGGAGCCGAGACGATGGCAAGTGTGG
CAAGCTCTGTGGAACCCAGCGCCGGCCTGCCTGACCGGATCAACTCGCGCGACGACGTCGTCAAATGCCT
CGATCTCGTGGTCGCCTTCTACGACCGCACCGAGCCGTCCAGCCCTATCCCGCACCTCGCCCGGCGCGTG
CGCAGGATGGTGCACATGGATTTCGTGGAACTGATGGAAGATCTCGCCCCGTCGGGGCTGAAGGAATTCC
GGCTGCTTGCCGGTGTCGCCGATCCCAAGAAGCCGGCCCAGAAGGATGAAAGGTAA