SecReT6
Protein ID: 13472138
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2337
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1886602..1887138 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ98IM5
KEGG IDmlo:mlr2337
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.10E-54, Aligned region: 10..170
Protein Sequence: 178 a.a.     [Download]
>gi|13472138|ref|NP_103705.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MPAESKAKVIERNRAPRVQIAYDVETYGSPTTIELPFVMAVMADLSGASQTKEASKSVLDRNFVETDANR
FPKFMEAMGPRVKARVKNTLPQAEGAERDEELAIDLTFSKMGDFAPDKVAEQVPQLAEILKMRRQLEELL
GFMDGRVDAEKRIAQLLNNEPLLSKIASQAISDGKGEE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1886602-1887138 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGCCAGCAGAGAGCAAAGCCAAGGTCATCGAAAGAAACCGCGCCCCGCGCGTGCAGATCGCCTACGACG
TCGAAACCTACGGCAGCCCCACGACGATCGAGTTGCCGTTCGTCATGGCTGTCATGGCCGACCTTTCCGG
CGCCTCGCAGACCAAGGAAGCGTCGAAGTCGGTTCTGGACCGCAATTTCGTCGAAACCGACGCCAATCGC
TTCCCCAAATTCATGGAAGCGATGGGACCACGCGTGAAGGCGCGCGTGAAGAACACGTTGCCGCAAGCCG
AAGGCGCCGAGCGGGACGAGGAACTGGCGATCGATCTCACCTTTTCCAAAATGGGCGATTTCGCGCCCGA
CAAGGTCGCCGAGCAGGTGCCGCAACTGGCCGAGATCCTCAAGATGCGGCGTCAGCTTGAGGAACTGCTG
GGCTTCATGGATGGCCGGGTCGACGCCGAAAAGCGCATCGCGCAGCTTCTGAACAACGAGCCGCTGCTGA
GCAAGATCGCCAGCCAGGCGATTTCTGACGGCAAGGGCGAGGAGTAA