SecReT6
Protein ID: 13472139
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2338
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1887142..1888647 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ98IM4
KEGG IDmlo:mlr2338
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.70E-176, Aligned region: 68..497
Protein Sequence: 501 a.a.     [Download]
>gi|13472139|ref|NP_103706.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MAEQQKTAAATAEAEAIDLGEFSGLLEKDFKVKKDDSEKLQQLVRNLALAAQSRSETTTISSNAIKSIKS
LIAGIDKMLTTQVNEILHAPEVREMEGTWRGLWYLINNTETDTKLKIRVMNISKEQLADTLEDYEGQMWD
QSPIFKKVYTDEYSMLGGEPIGCIIGAYEFSNHPRDVGLLRNISGVCASAHTPFIAAASPRLFRMDSWQE
LPNPQDLQMIVNNPAYASWQSLRESEDARYIGLTMPRVLARLPYGSETVPVKGFTFEEEVGGDHNKYVWM
NAAFPMGVNINRSHKLYGWGTQIRGVENGGTVLNLPVHAFPTDDGSIAMKCPTEVAIDDRREAELAKLGL
MPILHRKNTDLAAFIGAHSLQDDETRAGRLVDPDAQSNERLSANLPYLFPVSRFAHYLKAIARDKIGSFK
ERTDMEIWLTEWINRYVLANPAFADDKARAKRPLAAAEVQVDSVEGRPGYYNARFYLRPHYQLEGINASL
RLVSELPSVKG
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1887142-1888647 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGGCCGAACAGCAAAAGACCGCAGCCGCTACCGCCGAGGCCGAAGCCATCGATCTTGGCGAGTTCAGCG
GCCTCCTTGAAAAGGATTTCAAGGTCAAGAAGGACGACAGCGAGAAACTGCAGCAGTTGGTGCGCAACCT
GGCGCTGGCCGCTCAGTCCCGCTCCGAGACGACGACCATCTCGTCCAATGCGATCAAGTCGATCAAGTCG
CTGATCGCGGGCATCGACAAGATGCTGACGACGCAGGTCAACGAGATCCTGCATGCCCCGGAAGTGCGGG
AGATGGAAGGCACCTGGCGAGGCCTTTGGTACCTCATCAACAACACCGAGACAGACACCAAGCTGAAGAT
CCGGGTGATGAACATCTCCAAGGAGCAGTTGGCCGACACGCTGGAAGACTATGAAGGCCAGATGTGGGAC
CAGAGCCCGATCTTCAAGAAAGTCTACACGGACGAGTATTCGATGCTGGGCGGCGAGCCGATCGGCTGCA
TCATCGGCGCCTACGAATTCTCCAACCATCCGCGCGACGTCGGCCTGCTGCGCAACATCTCGGGTGTCTG
TGCCTCGGCGCACACGCCATTCATCGCGGCTGCCTCGCCGCGGCTGTTCCGTATGGACAGCTGGCAGGAA
CTGCCGAACCCGCAAGACCTGCAGATGATCGTCAACAACCCGGCCTATGCCTCATGGCAGTCGCTGCGCG
AGAGCGAGGACGCCCGCTATATCGGGCTCACCATGCCGCGCGTGCTGGCACGCCTGCCCTACGGCTCGGA
AACCGTTCCGGTGAAGGGCTTCACCTTCGAGGAAGAGGTGGGCGGCGACCACAACAAATATGTCTGGATG
AACGCCGCCTTCCCGATGGGCGTCAACATCAACCGCAGCCATAAGCTCTATGGCTGGGGAACGCAGATCC
GCGGCGTCGAGAATGGCGGCACGGTGCTCAACCTGCCGGTGCACGCTTTCCCGACGGACGACGGTTCGAT
CGCAATGAAATGCCCGACCGAGGTCGCCATCGACGACCGGCGCGAGGCGGAATTGGCGAAGCTTGGCCTG
ATGCCGATCTTGCACCGCAAGAACACCGATCTCGCAGCCTTCATCGGCGCGCACTCGCTCCAGGATGACG
AGACGCGCGCCGGGCGCCTCGTCGACCCCGACGCCCAGTCGAACGAACGGCTGAGCGCCAACCTGCCCTA
CCTCTTCCCGGTGTCGCGTTTCGCGCATTACCTCAAGGCGATCGCGCGCGACAAGATCGGATCGTTCAAG
GAACGCACCGATATGGAGATCTGGTTGACCGAATGGATCAACCGGTACGTGCTGGCCAATCCGGCCTTCG
CCGACGACAAGGCGCGGGCCAAGCGTCCGCTTGCCGCTGCCGAGGTTCAGGTCGACAGCGTCGAAGGCCG
GCCCGGTTACTACAACGCCCGTTTCTATCTGCGTCCGCACTACCAGCTGGAAGGCATCAACGCTTCCCTC
CGGCTGGTGTCGGAACTGCCGTCAGTGAAGGGCTGA