SecReT6
Protein ID: 13472140
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2339
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1888697..1889179 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ98IM3
KEGG IDmlo:mlr2339
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.80E-32, Aligned region: 17..146
Protein Sequence: 160 a.a.     [Download]
>gi|13472140|ref|NP_103707.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MPTTERSEAPSMKIDGFLKVPDIKGPSKRDGHEDEIEVHGVDYKMIAPYDPNSLSRRGRVSMGMIKFIKH
YDKSSPYLKKALFENKALDEVVFSARRTIDGETSDYLVVTLTDASVMEYDMRQATDEADLIEEEVSFAYK
KIKFVYDKDDEIEMDVYVGK
 
Nucleotide Sequence: 483 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1888697-1889179 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGCCGACCACAGAGAGAAGCGAGGCTCCTTCAATGAAGATCGATGGTTTTTTGAAAGTCCCGGACATCA
AGGGCCCGAGCAAGCGCGACGGCCATGAAGACGAGATCGAAGTGCATGGCGTCGATTACAAGATGATAGC
GCCCTACGACCCGAATTCGCTTTCGCGACGCGGCCGTGTGTCGATGGGAATGATCAAATTCATCAAGCAC
TACGACAAGTCGTCGCCATATCTGAAGAAGGCGCTGTTCGAGAACAAGGCGCTCGACGAGGTGGTGTTCT
CGGCACGCCGCACCATTGACGGCGAGACCAGCGACTATCTGGTCGTGACGCTCACCGACGCCTCGGTCAT
GGAGTACGATATGCGGCAGGCCACCGACGAGGCCGATCTTATCGAGGAAGAAGTCAGCTTCGCCTACAAG
AAGATCAAGTTCGTCTACGACAAGGACGACGAGATCGAAATGGACGTCTATGTCGGCAAGTGA