SecReT6
Protein ID: 13472141
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2341
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1889166..1889918 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ98IM2
KEGG IDmlo:mlr2341
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.90E-27, Aligned region: 106..231
Protein Sequence: 250 a.a.     [Download]
>gi|13472141|ref|NP_103708.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MSASEAKRLGAKSQLAGSSRAKREAVQPSLWDRLVNDLPGLASEIDGLRRLLDEELGAERVEALLAGSAR
GIDTDAELTPEQRRRLHRLVFQAEHRAEIESRGVVVSARVLREAVRRDIEALFNTERFESVPMLSDAEHE
QPLDELPSLADFPEVRRSVVNYGVPSFSGRSSRDFDRDVLAREIRAVLATFEPRLKESATTVNVTLGDKN
VGLKIEIDAVLIMAPTPERMRLRTTINLDNGLARTEFRET
 
Nucleotide Sequence: 753 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1889166-1889918 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGTCGGCAAGTGAGGCCAAGCGGCTTGGCGCGAAGTCGCAGCTTGCCGGCAGTTCGCGGGCAAAGCGCG
AGGCGGTCCAGCCCTCGCTCTGGGATCGCCTCGTCAACGACTTGCCGGGGCTGGCCTCGGAGATCGACGG
GCTGCGCCGGCTGCTGGATGAAGAACTCGGCGCCGAGCGCGTCGAGGCTCTTCTTGCCGGCAGCGCGCGC
GGCATCGATACCGACGCCGAACTGACGCCCGAGCAGAGACGGCGCCTGCACCGACTGGTCTTCCAGGCCG
AGCATCGCGCCGAGATCGAAAGCCGCGGCGTGGTGGTTTCGGCACGCGTGTTGAGAGAAGCCGTGCGGCG
CGACATCGAGGCCCTGTTCAACACCGAGCGCTTCGAATCCGTACCGATGCTCTCCGATGCCGAACACGAA
CAGCCCCTGGACGAACTGCCGTCGCTGGCCGACTTTCCGGAGGTACGCCGCAGCGTGGTCAATTATGGCG
TGCCGTCCTTTTCCGGCCGCTCTTCGCGGGATTTCGACCGCGATGTGCTGGCGCGCGAAATCCGCGCGGT
GCTTGCCACTTTCGAGCCGCGCCTGAAGGAGAGCGCCACGACCGTCAACGTCACGCTCGGCGACAAGAAC
GTCGGCCTCAAGATCGAGATCGACGCGGTGTTGATCATGGCCCCGACACCGGAGCGCATGCGGCTGCGCA
CCACGATCAATCTCGACAACGGGCTGGCACGAACCGAATTCCGGGAGACCTGA