SecReT6
Protein ID: 13472143
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2343
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1891758..1892825 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ98IM0
KEGG IDmlo:mlr2343
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-89, Aligned region: 25..327
Protein Sequence: 355 a.a.     [Download]
>gi|13472143|ref|NP_103710.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MADDARQSLPDLAESATVAAEPLLESFDFFELLRRLEQRRGLFGHSGTADREPARLGQHVRLSFSARDVI
KLQDAGEKAPARVTVANLGLLGPEGPMPLHLTRWVLDRLSQRWFTGADAEQTSDTTFVDFVNILQHRMMA
LYYRAWADAHPAVQVERSVGGRVRAMLEAMSGIGLPGTQDPELDTVRLRQAGSLASQIDGAERLTQFLAT
AFKVPVQIKEFVAAWISIPAALQTRLGKAHAGLGRGATIGPRVFSRQSRIELRVGPLSLDDFRSFLPGER
RLGLFKKAVRDMIGETLDVDLRIVLARDAVPSPQVGTVQLGRTAWLARPADRGDADDLRLHTIVGWRPQM
AEAAA
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1891758-1892825 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGGCCGATGACGCCCGGCAATCGCTACCTGATCTAGCGGAGTCCGCAACGGTCGCGGCCGAACCGTTGC
TGGAGAGCTTCGACTTTTTCGAGCTGTTGCGGCGCCTGGAGCAGCGCCGTGGATTGTTCGGCCATTCCGG
AACGGCCGACCGCGAGCCGGCAAGACTTGGCCAGCATGTGCGCCTGAGCTTCTCGGCCCGCGACGTCATC
AAGCTCCAGGACGCCGGGGAGAAGGCCCCCGCGCGGGTGACCGTCGCCAATCTCGGGCTGCTTGGGCCGG
AAGGACCGATGCCATTGCACCTGACACGCTGGGTGCTCGACCGGCTGTCGCAGCGCTGGTTCACCGGGGC
CGATGCCGAGCAGACCAGCGACACGACCTTCGTCGATTTCGTCAACATCCTGCAGCACCGCATGATGGCC
CTTTACTATCGCGCCTGGGCTGACGCGCATCCGGCGGTGCAGGTCGAGCGGTCCGTCGGCGGGCGTGTTC
GCGCCATGCTGGAGGCAATGTCCGGGATCGGTCTCCCCGGCACCCAGGATCCCGAACTCGACACTGTGCG
ACTGCGACAGGCTGGATCGCTCGCCAGCCAGATCGACGGCGCGGAGCGGCTGACGCAGTTTCTCGCCACC
GCCTTCAAGGTGCCGGTGCAGATCAAGGAATTCGTCGCCGCTTGGATCAGCATTCCGGCGGCACTGCAGA
CGCGTCTCGGCAAGGCCCATGCCGGGCTCGGACGCGGCGCGACGATCGGGCCGCGGGTCTTCAGCCGCCA
AAGCAGGATCGAACTGCGCGTCGGTCCGCTGAGCCTCGACGACTTCAGGTCGTTCTTGCCCGGCGAACGG
CGTCTTGGCCTGTTCAAGAAGGCGGTGCGCGACATGATCGGCGAGACGCTCGACGTCGATTTGCGCATCG
TGCTCGCGCGCGACGCCGTGCCGTCGCCACAGGTCGGGACCGTCCAGCTTGGCCGGACCGCCTGGCTGGC
ACGTCCCGCCGACAGGGGTGATGCCGACGATCTCAGATTGCACACCATCGTCGGCTGGCGGCCGCAAATG
GCGGAGGCGGCCGCATGA