SecReT6
Protein ID: 13472144
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2345
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1892822..1894282 [+]
Producthypothetical protein
NoteFha
UniProt IDQ98IL9
KEGG IDmlo:mlr2345
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.50E-12, Aligned region: 27..95
Protein Sequence: 486 a.a.     [Download]
>gi|13472144|ref|NP_103711.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MSLLLTLEQGPRSQVVRQTRLDEGELVIGRSADAGWQIDDPDMFVSRAHCKIRGDRDGYFVTDTSSSGLF
VDDSDSPLGPGRSMRLQSGMRLRMGDYIFHVEVQSKANRTSVGPAPVTGQPAPAWSSQGARTPASIGGDD
FFSAKVEEEPRPPRPSDLPNPFEQPVPGAYDRASSQRSSPAFDDPFSLDPVATSPSSDLAAPDQPDPFGF
GEMPSRNDASGHAAKPASFDDDFSFGPAATPPLANGADPSGRVQHQAEKPRAAHPWDVPAQAAEPPPPRR
AAPTPRPARPAQSASGDMALRAAFLRGMGVEEADFPGRDPIAEMEKFGREYRLMLDGLMQLLRKRAEEKG
SARVAQTVVGASEVNPLKFLPTAEDVIVTIISERSPGFLSGEAAINDAVKDLAQHHIRAWRGVQAALRRM
IDRFDPAAIEEELKSNSAIGNLLSGGRNAKLWELYQKRHRDIAQSAESSFLGEIGADFRDAYEEEE
 
Nucleotide Sequence: 1461 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1892822-1894282 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGAGCCTGCTGCTGACGCTGGAACAAGGCCCCCGCTCGCAAGTGGTCAGGCAGACCCGGCTTGACGAGG
GCGAATTGGTGATCGGGCGCAGCGCCGACGCCGGCTGGCAGATCGACGACCCGGACATGTTCGTCTCGCG
CGCGCATTGCAAGATCCGCGGCGACCGGGATGGCTATTTCGTCACCGACACGTCGAGCAGCGGATTGTTC
GTCGATGACTCCGACAGCCCCCTGGGTCCTGGCAGGTCGATGCGGCTGCAGAGCGGCATGCGGCTGCGCA
TGGGCGACTATATCTTCCACGTCGAGGTTCAATCCAAAGCGAACCGGACGTCGGTCGGCCCAGCCCCTGT
CACCGGCCAACCCGCGCCTGCGTGGTCATCGCAGGGAGCGCGAACGCCTGCCAGCATCGGCGGTGACGAC
TTCTTCTCGGCCAAGGTCGAGGAAGAACCGCGCCCGCCACGCCCGTCGGACTTGCCGAACCCGTTCGAGC
AGCCTGTTCCCGGGGCTTATGACCGCGCATCCAGCCAACGCAGTTCGCCCGCCTTTGACGACCCGTTCAG
CCTCGACCCGGTGGCGACGTCGCCGTCAAGTGATCTCGCCGCTCCGGATCAGCCGGATCCGTTCGGCTTC
GGCGAAATGCCTTCGCGCAACGATGCGTCCGGGCATGCGGCAAAGCCGGCCAGCTTCGATGACGATTTCA
GCTTTGGGCCGGCCGCGACCCCGCCTCTCGCCAACGGCGCCGACCCGTCAGGACGTGTGCAGCATCAGGC
TGAAAAGCCGCGCGCAGCACATCCCTGGGATGTGCCGGCTCAGGCAGCCGAGCCACCGCCGCCGCGACGC
GCCGCTCCGACGCCCAGGCCGGCGCGCCCGGCGCAGTCCGCATCCGGCGATATGGCGCTGCGTGCCGCAT
TCTTGCGCGGCATGGGCGTCGAGGAGGCCGATTTCCCAGGCCGCGATCCGATCGCCGAAATGGAAAAATT
CGGGCGTGAATACCGGCTGATGCTGGATGGCTTGATGCAACTCCTGCGCAAGCGCGCCGAGGAGAAGGGA
AGCGCGCGCGTCGCCCAGACGGTGGTCGGTGCTTCCGAGGTCAACCCGCTCAAATTCCTGCCGACGGCCG
AGGATGTCATCGTCACCATCATCTCGGAACGCAGTCCGGGCTTTCTCTCCGGCGAGGCGGCGATCAACGA
TGCGGTAAAGGACCTTGCACAGCATCACATACGCGCTTGGCGCGGCGTTCAGGCCGCGCTTCGGCGCATG
ATCGACCGTTTCGATCCGGCCGCGATCGAGGAAGAGCTCAAGTCCAATTCCGCCATCGGCAATCTGCTCT
CCGGCGGGCGTAACGCCAAGCTGTGGGAGCTCTACCAGAAACGCCATCGCGACATCGCCCAGAGCGCGGA
ATCGAGCTTCCTGGGCGAGATCGGCGCAGACTTCAGGGACGCATATGAAGAGGAGGAGTAG