SecReT6
Protein ID: 13472145
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2346
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1894286..1894738 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ98IL8
KEGG IDmlo:mlr2346
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.80E-28, Aligned region: 16..148
Protein Sequence: 150 a.a.     [Download]
>gi|13472145|ref|NP_103712.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MIDRREFVVALGATGLLAACQSGPPKPSVISVNVTGGAGMNPGPGGGDRPVTVLVMRLASTGKFNSADYF
ALQGDAGSALGADLIGSDAISVAPGKTAAKTITVEPNATALGFVALIREPGGRNWRTTKSVSPGSKFTIN
VSLGKGGISA
 
Nucleotide Sequence: 453 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1894286-1894738 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGATCGACAGACGCGAATTCGTCGTTGCCCTCGGCGCCACGGGGCTGCTTGCGGCTTGCCAGAGCGGCC
CACCGAAACCATCGGTTATCTCGGTCAACGTGACCGGCGGCGCCGGCATGAATCCAGGACCGGGCGGCGG
CGACAGGCCGGTGACGGTACTGGTGATGCGGCTTGCCAGCACCGGCAAGTTCAACTCGGCCGACTATTTC
GCGCTGCAGGGCGATGCGGGCTCGGCGCTCGGTGCCGACCTCATCGGCTCCGACGCGATCTCGGTCGCGC
CGGGCAAGACGGCGGCCAAGACCATCACGGTCGAGCCGAACGCCACGGCACTCGGCTTCGTGGCGCTGAT
CCGCGAGCCGGGCGGACGCAACTGGCGCACGACCAAGTCGGTATCGCCAGGGTCGAAATTCACCATCAAT
GTCAGCCTCGGCAAGGGCGGCATTTCCGCCTAG