SecReT6
Protein ID: 13472146
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2347
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1894779..1896113 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ98IL7
KEGG IDmlo:mlr2347
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.40E-117, Aligned region: 19..442
Protein Sequence: 444 a.a.     [Download]
>gi|13472146|ref|NP_103713.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MSDANRVLWSEGLFLRTQHFQQQDRFFEGMVRGALQAGQLHTFGFQQLTLDQSLLDAGQVSIVSARGIFP
DGTPFSIPELMDAPKPLPVTADTGAGPVLVALPLEPPGGVGFDPAHAASTGARYHGKIVSVRDAVQSGAD
PEEIEIARPQAALLAPGKSVGGYTALPIADIKGVRADGGISLDETFLPPTLITGAVHWYRQLLQEVVTGL
DQIAEAHGKMVMGGAGRSVEDLLMLHLANAARPRLAHMLAQDVFHPAELYLELAGLAGEMATYGSSSRRL
GELPAYDHMAPGPAYMALADALRSLILSLRYIEPKSRALPVMRHATNVWKVRIDNPKLLVASRIVIRVGS
ELSEDALRKIFVNQATVGAADQFEGLWKSRLPGIPLKPLHSQPREIPYDGDRLCLELDQKSEHWASLLDA
PGFVIGVSGVLPSEPQVDCYSVNR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1894779-1896113 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGAGCGATGCAAACAGGGTGCTGTGGTCGGAGGGCCTGTTTCTCAGGACCCAGCACTTCCAGCAGCAGG
ATCGGTTCTTCGAGGGCATGGTGCGCGGTGCATTGCAGGCCGGCCAGCTCCATACTTTCGGCTTCCAGCA
ACTGACCCTCGACCAGTCGCTGCTCGACGCCGGCCAGGTCTCGATCGTGTCCGCCCGGGGCATTTTCCCG
GACGGCACGCCTTTCTCCATCCCGGAACTGATGGATGCGCCCAAGCCGCTGCCGGTCACGGCCGACACCG
GCGCCGGTCCGGTGCTGGTCGCATTGCCGCTCGAGCCACCCGGTGGCGTCGGGTTCGATCCGGCGCATGC
GGCATCGACGGGCGCGCGCTACCACGGCAAGATCGTTTCGGTGCGCGACGCCGTCCAGAGCGGCGCCGAT
CCGGAAGAGATCGAGATCGCCCGCCCGCAAGCCGCCCTGCTTGCGCCCGGCAAATCGGTCGGCGGTTATA
CGGCCTTGCCGATCGCCGACATAAAGGGTGTGCGCGCCGACGGCGGCATCTCGCTCGATGAGACGTTCCT
GCCGCCGACGCTGATCACCGGCGCAGTCCACTGGTACCGGCAATTGTTGCAGGAGGTCGTCACCGGCCTC
GACCAGATCGCCGAAGCGCATGGCAAGATGGTGATGGGCGGCGCCGGCCGCAGCGTCGAAGACCTTTTGA
TGCTGCACCTCGCCAATGCCGCTCGCCCGCGGCTTGCCCATATGCTCGCGCAGGATGTCTTTCATCCGGC
CGAACTCTATCTCGAACTGGCCGGACTGGCCGGCGAGATGGCAACCTACGGCTCGAGCTCGCGGCGGCTC
GGCGAATTGCCGGCCTACGATCACATGGCGCCCGGCCCCGCCTATATGGCGCTGGCCGATGCCTTGCGCT
CGCTCATTCTCAGCCTGCGCTACATCGAGCCGAAATCGCGCGCGCTGCCGGTCATGCGGCACGCGACCAA
TGTCTGGAAAGTGCGCATCGACAACCCGAAGCTCTTGGTCGCCAGCCGCATCGTCATCCGCGTCGGATCG
GAACTGTCGGAAGACGCGCTGCGCAAGATCTTCGTCAACCAGGCGACGGTCGGCGCCGCTGACCAGTTCG
AAGGTCTTTGGAAGTCGCGCCTGCCGGGTATTCCGCTGAAACCGCTTCATTCGCAGCCACGCGAGATCCC
CTACGATGGCGACCGGCTGTGCCTGGAGCTTGACCAGAAGAGCGAGCATTGGGCCTCGTTGCTCGACGCC
CCCGGCTTCGTCATCGGCGTTTCAGGTGTCCTGCCGAGCGAGCCGCAGGTCGACTGCTACTCAGTGAACA
GGTGA