SecReT6
Protein ID: 13472147
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2348
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1896118..1897446 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ98IL6
KEGG IDmlo:mlr2348
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.50E-58, Aligned region: 45..250
OmpA [PF00691], Evalue: 4.30E-18, Aligned region: 330..432
Protein Sequence: 442 a.a.     [Download]
>gi|13472147|ref|NP_103714.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MSRDDPFGLSEDRERTRIRLAGAAPRPMAPLAPGAPVKRARAHPNTLINIFAPLLEFAPELESALAPENP
EAMRTRLLDELVQARDAAMAAGSSLERADQAAWAVAALLDDLALNTPWGGASAWPRQPLVVMLRGDVDAG
TQFFTRLDELERHPNRDREMLELQYYCLALGFRGKYRVPGRAGDRSLNAVRVAAARFLRNADAEDAPLSP
NWKGVIASDEPQRFIVPIWVMALAAVVVAAVAYIGLSMSLSSQAVELSALVRTLPPASRADVARAAPKQD
APAPEPPQPVDFALLPAFKAEAPASLKDALSGTESVSLAKLIIQSSNPELFQSSRPTLSQGYEPLIQSIA
KVILANQELIGNITIVGHTDNVRLQRSNPLASNQRLSEARAQTIADLLVQAGVPQERIHSEGRADSDPVA
DNSTREGRALNRRVEVLVEKRL
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1896118-1897446 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGAGCCGGGATGATCCTTTCGGACTGTCGGAGGATCGCGAACGCACACGCATCAGGCTGGCGGGCGCCG
CGCCACGGCCGATGGCGCCGCTGGCACCGGGCGCGCCGGTCAAAAGGGCGCGCGCCCATCCCAACACGCT
CATCAATATCTTCGCGCCATTGCTCGAATTCGCGCCGGAGCTCGAAAGCGCGCTGGCGCCGGAGAACCCG
GAAGCGATGCGCACGCGCCTGCTAGACGAGCTGGTTCAGGCGCGCGACGCCGCGATGGCGGCAGGCTCTT
CGCTGGAGCGCGCCGACCAGGCGGCCTGGGCCGTGGCGGCGTTGCTCGACGACCTCGCGCTGAACACGCC
ATGGGGTGGCGCCAGCGCCTGGCCGCGCCAGCCGCTGGTGGTCATGCTGCGTGGCGATGTCGATGCCGGT
ACCCAGTTTTTCACCCGCCTTGACGAGCTGGAGCGCCATCCCAACCGCGACCGCGAGATGCTGGAGCTTC
AGTATTACTGCCTGGCGCTCGGCTTCCGCGGCAAGTACCGGGTGCCCGGCCGCGCCGGCGACCGCTCGCT
CAATGCCGTGCGTGTGGCAGCCGCGCGCTTCCTGCGCAATGCCGACGCCGAGGACGCGCCGCTGTCGCCG
AACTGGAAAGGCGTGATCGCTTCCGACGAGCCGCAGCGCTTCATCGTTCCGATCTGGGTGATGGCACTTG
CCGCGGTTGTCGTCGCCGCCGTCGCTTATATCGGTCTGTCGATGAGCTTGAGCAGCCAGGCGGTCGAACT
CTCCGCCCTCGTGCGCACGCTGCCGCCGGCCTCGCGCGCCGACGTTGCCCGCGCCGCGCCCAAGCAGGAT
GCGCCCGCACCCGAACCGCCACAGCCGGTCGATTTCGCGCTGCTGCCCGCATTCAAGGCCGAAGCGCCGG
CGAGCCTCAAGGACGCGCTCAGCGGCACTGAGAGCGTCTCGCTGGCCAAGCTGATCATCCAGTCCTCCAA
CCCCGAACTCTTCCAGTCTTCGCGGCCGACACTGTCGCAAGGCTATGAACCGCTGATCCAGTCGATCGCC
AAGGTGATCCTCGCCAATCAGGAGCTGATCGGAAACATCACGATCGTCGGCCATACCGACAATGTGCGCC
TGCAAAGGTCCAATCCGCTCGCGAGCAACCAGCGGCTCTCGGAGGCGCGTGCCCAAACCATAGCGGACCT
CCTGGTGCAGGCTGGCGTGCCACAGGAGCGCATCCATTCCGAAGGCCGCGCCGACTCCGATCCGGTCGCC
GACAACTCGACGCGCGAGGGCCGCGCGCTCAACCGGCGCGTCGAGGTCCTGGTCGAAAAGAGGCTCTGA