SecReT6
Protein ID: 13472156
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmll2357
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1906557..1908884 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ98IK7
KEGG IDmlo:mll2357
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-76, Aligned region: 27..324
Phage_base_V [PF04717], Evalue: 4.30E-24, Aligned region: 365..458
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 505..519
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 523..546
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 548..562
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 563..586
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 589..610
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 607..619
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 624..642
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 644..661
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 662..682
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 678..693
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 713..719
Gp5_C [PF06715], Evalue: 1.00E-07, Aligned region: 749..761
DUF2345 [PF10106], Evalue: 0.00022, Aligned region: 553..581
DUF2345 [PF10106], Evalue: 0.00022, Aligned region: 629..763
Protein Sequence: 775 a.a.     [Download]
>gi|13472156|ref|NP_103723.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MPNERATVVHTPVGADVLTFTHLVGRDEISRSFAYTVGFVSKSRDVDPLKMLGGVVSVEGESDPKRWFSG
LVSDFKLTRIEDRLAYYEATVRPWLWFLGNTTDCRIFQNMTAVEIVEKIFSKYGIAKFEKRLQGSYPSRE
YCVQYDESDLDFVQRLFEHEGIFYFFEHDEDKHTLVLCDAMSKLKPAPGYEKVLYNFEGYGSRRDVEYIT
EWIPGSAVRPGAYAHTDYDFEKPGADLMAKSAQSFSHKEASGENYRQPGAHLDVGRGDTIAGIRREELQA
VHQRNTAVGTVRGLFSGCKFTLESFPRDDQNAEYLVVSAEYRLFDPGYRTQNEAHSENFKVVLGVAPTKL
PYRPPRITPRPIMRGPQTATVVGPSGEEIFTDKYARVKVQFHWDRLGKKDQNSSCFVRVSQTWAGSGWGF
IQIPRIGQEVIVDFIEGDPDLPIITGRVYNASEMPPYALPGNATQSGWKSNSSKGGGGYNELMFEDKAGS
ELVNFQAQKDHHLLIKHDRNKTVQHDQSDRIDHDAKHSVGHNLDEDVGNNKTVKIGVDQTTNIGSNDTET
VGANRSLTVMANETIHVVANSTENIDASHSQTVGLVQTVTVGAARVDTVGATETRSVGAAQMNTIGASRS
VTVGAGQSHDIGADDGWNVEASQSIEIGADQGLKIGGAQNTEIGKTWTVKVGQDASTQIDGAHELKIGKK
SLTQVGEDAGMVVGKNLTIEAKDSITIKTGSAEILMKKDGTITIKGKDITVKGSGKINVDASSDIVMKGS
NILQN
 
Nucleotide Sequence: 2328 bp     [Download]
>gi|57165207|ref|NC_002678.2|:c1908884-1906557 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGCCGAACGAACGTGCCACGGTTGTACACACGCCGGTTGGCGCCGATGTGCTGACCTTCACCCATCTCG
TCGGTCGTGATGAGATCAGCCGAAGTTTTGCCTATACTGTCGGGTTCGTCAGCAAGAGCCGTGACGTCGA
TCCGCTGAAGATGCTGGGTGGCGTCGTTTCGGTCGAAGGTGAATCCGATCCAAAGCGCTGGTTCAGCGGC
CTGGTGTCGGATTTCAAGCTTACACGCATAGAGGATCGGCTGGCCTACTACGAGGCCACCGTCAGGCCGT
GGCTCTGGTTCCTCGGCAACACCACCGATTGCCGCATTTTCCAGAACATGACCGCTGTGGAGATCGTCGA
AAAGATCTTTTCGAAATACGGTATCGCAAAATTCGAGAAGCGCCTGCAGGGCTCGTATCCATCACGCGAA
TACTGTGTCCAGTATGATGAGAGTGATCTCGATTTCGTGCAGCGGTTGTTCGAGCACGAAGGTATTTTCT
ATTTCTTCGAGCATGATGAGGACAAGCACACGCTCGTGCTGTGCGATGCGATGAGCAAGCTGAAGCCGGC
TCCAGGCTACGAGAAGGTGCTTTATAATTTCGAGGGCTATGGCTCGCGACGCGACGTCGAATACATCACC
GAATGGATTCCGGGCAGTGCGGTGCGGCCAGGCGCCTACGCCCACACGGACTATGACTTCGAGAAGCCCG
GCGCCGATCTGATGGCGAAGTCCGCCCAGTCTTTCAGCCACAAGGAGGCTTCGGGCGAAAACTACCGCCA
GCCCGGAGCGCATCTCGATGTCGGGCGCGGCGATACGATCGCCGGGATCCGCCGCGAGGAACTTCAGGCA
GTGCATCAGCGCAATACCGCCGTGGGTACGGTGCGTGGCCTTTTTTCCGGCTGCAAGTTCACGCTCGAAA
GCTTTCCGCGCGACGACCAGAATGCGGAATATCTGGTTGTGAGTGCCGAATACCGACTGTTCGATCCGGG
CTACCGGACCCAGAACGAAGCCCACAGCGAGAATTTCAAGGTGGTGCTGGGCGTAGCGCCCACGAAATTG
CCCTATCGGCCACCGCGCATCACGCCAAGACCGATCATGCGCGGCCCGCAGACGGCAACGGTGGTCGGCC
CTTCGGGCGAGGAGATATTCACCGACAAATACGCGCGGGTGAAGGTGCAATTCCATTGGGACCGCCTTGG
CAAGAAGGACCAGAACTCGTCCTGCTTCGTGCGTGTGTCTCAGACCTGGGCCGGCAGCGGCTGGGGCTTC
ATCCAGATCCCGCGCATCGGCCAGGAGGTCATCGTCGATTTCATCGAGGGCGATCCGGACCTGCCAATCA
TCACCGGCCGCGTCTACAATGCCTCCGAGATGCCGCCTTACGCGCTGCCGGGCAACGCCACGCAATCGGG
CTGGAAGTCCAATTCCTCGAAAGGCGGCGGCGGTTACAACGAGCTCATGTTCGAGGACAAGGCCGGTTCC
GAACTGGTCAATTTCCAGGCGCAGAAGGACCACCATCTGCTGATCAAGCACGACCGCAACAAGACGGTGC
AGCACGACCAGTCCGACCGCATCGACCATGACGCCAAGCACTCCGTCGGCCATAACCTCGATGAGGACGT
CGGCAACAACAAGACGGTCAAGATCGGCGTCGACCAGACGACGAACATCGGGTCGAACGACACGGAGACG
GTGGGTGCGAACCGCTCGCTGACGGTGATGGCGAACGAGACGATCCACGTCGTCGCCAATTCGACGGAAA
ACATCGACGCCAGCCACTCGCAGACGGTCGGGCTGGTGCAGACGGTGACGGTCGGCGCGGCGCGCGTCGA
TACCGTGGGCGCCACTGAGACACGAAGCGTCGGCGCGGCGCAGATGAATACGATCGGGGCTTCACGTTCG
GTTACGGTGGGAGCGGGGCAGAGCCACGATATTGGGGCGGATGATGGCTGGAACGTAGAGGCCAGCCAAA
GCATCGAGATCGGCGCCGATCAGGGCCTCAAAATCGGCGGCGCGCAGAACACCGAGATCGGCAAGACATG
GACCGTCAAGGTCGGCCAGGATGCCTCGACCCAGATCGACGGGGCGCACGAACTCAAGATCGGCAAGAAG
AGCCTCACCCAAGTTGGCGAGGATGCGGGGATGGTGGTCGGCAAGAACCTGACCATCGAAGCCAAGGACT
CGATAACGATCAAGACCGGTAGTGCCGAGATCCTTATGAAGAAGGATGGAACGATCACCATCAAGGGAAA
GGACATTACGGTCAAAGGTTCGGGAAAGATCAATGTCGACGCTTCGAGCGATATCGTCATGAAGGGCAGC
AACATCCTGCAGAATTGA