SecReT6
Protein ID: 13472157
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2358
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1909132..1910211 [+]
Producthypothetical protein
NoteFha
UniProt IDQ98IK6
KEGG IDmlo:mlr2358
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.30E-18, Aligned region: 29..94
Protein Sequence: 359 a.a.     [Download]
>gi|13472157|ref|NP_103724.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MFITLQISNVDRLPPGIAASYAARDRSFEIGRENCDWTLSDPDKFISGRHCEIRYQAGTFWLHDVSRNGT
FVNGSSQRMNAPHRLTQGDRLLIGRYVVAVSVDEERVATGHPQARTGSTQRELPPSTGTPLKLGSALFHN
LGEQRPAEVTPVPASSVLQSSPAVPAKQPGEAEGILRDIARAAGLSPELLQSRDPHDVAAEIGAVLRTTV
EQLSLLLKARAAAKVLAKSAHRTMIGAEDNNPLKFVPGTDDILEIMFAKRRAGYLDARHSIEDAFRDLKT
HEIATYAAMQAALSRLLDDLSPEAIAKRIPPASFSSRKSQAWDALVATWRTMEDKHENGMLDVFLAYFAE
AYAKADKQK
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1909132-1910211 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGTTCATTACACTCCAGATCAGCAATGTTGACAGGCTGCCACCAGGCATCGCGGCGAGCTATGCCGCGC
GCGACCGCAGCTTCGAAATCGGGCGCGAAAATTGTGACTGGACACTTTCCGATCCCGACAAGTTCATCTC
GGGCCGGCACTGCGAAATCCGCTATCAGGCCGGCACGTTCTGGCTTCATGATGTCTCGCGCAACGGCACC
TTCGTCAACGGCTCCAGCCAGCGCATGAATGCGCCGCATCGGCTAACCCAAGGCGACCGGCTGCTGATCG
GCCGCTACGTCGTCGCCGTTTCGGTCGACGAAGAGCGCGTCGCCACCGGTCATCCGCAAGCCAGGACCGG
TTCGACGCAACGCGAGTTGCCGCCCTCGACGGGGACACCGCTGAAACTCGGCAGCGCGTTATTCCACAAT
TTGGGGGAGCAGCGCCCGGCCGAGGTAACGCCGGTGCCGGCGTCTTCTGTGCTGCAGTCCAGCCCCGCTG
TCCCGGCCAAGCAGCCAGGGGAAGCGGAGGGGATACTGCGCGATATCGCCAGGGCCGCCGGCTTATCGCC
GGAGTTGTTGCAGTCGCGCGACCCGCATGACGTCGCTGCCGAGATCGGTGCGGTGTTGAGAACCACGGTC
GAGCAACTGTCCTTGCTGCTCAAGGCGCGCGCCGCGGCCAAGGTGCTCGCCAAAAGCGCGCACCGCACCA
TGATCGGCGCCGAGGACAACAACCCGCTGAAATTTGTGCCGGGCACCGACGACATACTCGAGATCATGTT
TGCCAAGCGCCGGGCCGGCTATCTCGATGCCAGACACAGCATCGAGGATGCGTTCCGAGACCTGAAGACC
CACGAAATCGCTACCTACGCAGCCATGCAGGCCGCGCTCTCGAGGCTGCTCGACGACCTGTCGCCGGAGG
CGATCGCCAAAAGAATCCCGCCTGCGTCCTTTTCGTCCAGGAAAAGCCAGGCCTGGGACGCGCTCGTCGC
AACGTGGCGGACGATGGAGGACAAGCACGAAAACGGCATGCTGGATGTCTTCCTCGCTTATTTCGCCGAA
GCCTACGCCAAGGCTGACAAGCAGAAATAG