SecReT6
Protein ID: 13472158
SecReT6 ID7
T6SS typei3
Gene symbol-
Locus tagmlr2359
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T6SS(s) in this replicon]
Location [Strand]1910475..1911989 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ98IK5
KEGG IDmlo:mlr2359
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-56, Aligned region: 96..300
OmpA [PF00691], Evalue: 3.70E-16, Aligned region: 384..483
Protein Sequence: 504 a.a.     [Download]
>gi|13472158|ref|NP_103725.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MSSKDDPPEPPDKTVIRAPRPRQKPRVAPDSSGAPSPSRESTVFDPGLGRQMPPGWSSETMVFQEAGHGA
ESAAAPALQQDALLNATAGVKYAAANPILAAAAPLLMLFGQLRLIPVERQAAALAEHIADAIETFDHTIA
KAGIGEEDARIAKFALCETTDDLVGNLPWPNKETWLQHSLVVQFFHTRPTGTGFYEALNNILAKPEAHYD
LLELMHACLSLGFEGQYRELSGERNTLERVRRDVYDTLRYFRPRAAEDISPRWQGMAAAMARPGGRLPLW
AIAAAAAALVTVAFFGLRILITDEGDATAGALLALNPSAPVTIERASVAAPAEPVQAKPPSPIHPDTTQI
DRIRAALAQQIAAGGLGVGTKGDFIVVEISNQLLFASGQAELKAQFQPIAADIAKALDAEAGPIKIVGHT
DNVKPKKSSAFKSNFDLSVARAKAVQAMIARQLKDPSRLSVDGKGEDEPIADNATADGRAKNRRVDVMIP
KQETLQAGSAENGN
 
Nucleotide Sequence: 1515 bp     [Download]
>gi|57165207|ref|NC_002678.2|:1910475-1911989 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGAGCTCGAAGGACGATCCCCCCGAGCCGCCGGACAAAACCGTCATCCGCGCGCCACGGCCAAGGCAAA
AGCCGCGCGTGGCTCCCGATAGTTCCGGTGCGCCATCACCCTCCAGGGAATCGACGGTGTTCGACCCCGG
GCTCGGCCGGCAAATGCCCCCCGGCTGGTCGTCCGAAACCATGGTCTTTCAGGAAGCCGGCCACGGAGCT
GAGTCCGCGGCGGCGCCGGCGTTGCAGCAGGACGCCTTGCTCAATGCCACAGCTGGCGTGAAGTATGCCG
CGGCAAATCCTATTCTTGCCGCCGCGGCCCCCTTGCTCATGCTGTTCGGTCAGCTACGGCTGATACCAGT
CGAACGGCAAGCCGCAGCCTTGGCGGAGCATATCGCAGACGCCATCGAAACCTTCGACCACACTATCGCC
AAAGCCGGTATTGGGGAAGAAGACGCACGGATCGCGAAATTTGCGCTTTGCGAAACCACCGACGATCTCG
TCGGCAACCTGCCCTGGCCGAACAAGGAAACCTGGCTTCAGCACAGTCTGGTGGTGCAGTTCTTCCACAC
ACGACCGACAGGCACCGGCTTCTATGAAGCGCTGAACAACATCCTCGCCAAGCCTGAAGCGCATTACGAC
CTGCTCGAATTGATGCATGCCTGCCTGTCGCTGGGGTTCGAGGGCCAGTATCGGGAATTGTCCGGCGAAC
GGAACACACTCGAGCGCGTCCGGCGCGACGTCTACGACACGCTGCGCTATTTCAGGCCGCGCGCCGCCGA
GGACATTTCGCCCCGGTGGCAAGGCATGGCGGCGGCAATGGCCAGGCCAGGAGGGCGGCTGCCTCTATGG
GCGATCGCAGCAGCCGCGGCGGCCCTGGTGACGGTGGCCTTTTTCGGGCTGCGGATATTGATCACCGATG
AAGGCGATGCAACCGCCGGCGCGCTGCTGGCGCTCAATCCTTCCGCCCCGGTTACCATTGAACGCGCCAG
CGTGGCGGCGCCCGCCGAACCGGTGCAAGCCAAGCCGCCGTCACCGATCCACCCGGACACCACGCAGATC
GACCGCATCCGCGCGGCACTCGCCCAGCAGATCGCCGCCGGAGGGCTGGGCGTCGGCACGAAGGGCGACT
TCATCGTTGTCGAGATCAGCAACCAGCTTCTGTTCGCATCCGGCCAGGCTGAGTTGAAGGCACAGTTCCA
GCCGATCGCGGCCGATATCGCCAAGGCGCTCGACGCCGAAGCCGGACCGATCAAGATCGTCGGCCACACC
GACAATGTGAAGCCGAAGAAGTCGAGCGCGTTCAAATCGAATTTCGATCTCTCGGTCGCCCGCGCGAAAG
CCGTGCAGGCGATGATCGCCAGGCAATTGAAGGATCCATCGCGTCTGAGCGTAGACGGCAAGGGCGAAGA
CGAACCCATCGCCGACAACGCGACGGCGGACGGCCGCGCCAAGAACCGCCGCGTCGACGTGATGATCCCG
AAACAGGAGACCTTGCAGGCCGGCTCGGCGGAGAACGGCAACTGA