SecReT6
Protein ID: 145299402
SecReT6 ID199
T6SS typei1
Gene symbolvgrG/insA
Locus tagASA_2455
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2614444..2615091 [-]
ProductvgrG/InsA fusion protein
NoteTssI
UniProt IDA4SNM3
KEGG IDasa:ASA_2455
PDB IDNA
Domain hit(s) vs Pfam HTH_Tnp_IS1 [PF12759], Evalue: 2.90E-25, Aligned region: 160..203
Zn_Tnp_IS1 [PF03811], Evalue: 1.20E-09, Aligned region: 124..151
Phage_GPD [PF05954], Evalue: 3.10E-07, Aligned region: 29..96
Protein Sequence: 215 a.a.     [Download]
>gi|145299402|ref|YP_001142243.1| vgrG/insA gene product [Aeromonas salmonicida subsp. salmonicida A449]
MADSTGLQFTVKVGALPESTFVVAEFALEEALNSPFQLRLELASPQPDVDFADVLDQPCELLVWYNGELQ
RRVCGVVSDFAQGDSGFRRTRYQLLVQQAVMPPSVDAAWWVPLRLSNSWYTSPHCPRFNSDHVYRHGKTP
AGHVRYRCPACPHVFQLTNTYEARKLGVKEKIVDMAFNGAGVRDTARALNTGINTVLRALKNSPQGSNLR
KGSAG
 
Nucleotide Sequence: 648 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2615091-2614444 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGGCAGACAGCACAGGATTACAATTTACCGTCAAGGTAGGGGCGCTGCCCGAGAGCACTTTCGTGGTGG
CCGAGTTTGCGCTGGAAGAGGCGCTGAACAGCCCGTTCCAGTTGCGGTTGGAATTGGCCAGCCCCCAGCC
GGATGTCGATTTTGCCGATGTGCTGGACCAGCCGTGCGAGCTCCTGGTGTGGTACAACGGTGAGTTGCAG
CGGCGGGTGTGCGGGGTAGTCAGTGATTTTGCGCAAGGGGACAGCGGCTTTCGCCGTACCCGCTACCAGC
TGCTGGTGCAGCAGGCGGTGATGCCTCCATCGGTTGATGCGGCATGGTGGGTTCCTTTGAGGCTCAGCAA
TTCATGGTATACATCACCTCACTGTCCTCGTTTCAACTCCGACCACGTATATCGCCACGGTAAGACTCCT
GCCGGTCACGTTCGCTATCGTTGTCCAGCCTGCCCCCACGTTTTTCAGCTCACCAACACCTATGAGGCCC
GTAAACTCGGCGTTAAAGAGAAGATTGTTGATATGGCGTTCAACGGGGCTGGTGTCCGTGATACTGCTCG
CGCCCTTAACACTGGCATTAACACCGTCCTGCGCGCCCTAAAAAACTCGCCCCAAGGCAGTAACCTCCGA
AAAGGTAGTGCTGGATGA