SecReT6
Protein ID: 145299404
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2457
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2615682..2617118 [-]
Producthypothetical protein
NoteTssA
UniProt IDA4SNM5
KEGG IDasa:ASA_2457
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.90E-39, Aligned region: 273..287
DUF3702 [PF12486], Evalue: 1.90E-39, Aligned region: 326..473
ImpA-rel_N [PF06812], Evalue: 4.20E-19, Aligned region: 42..101
Protein Sequence: 478 a.a.     [Download]
>gi|145299404|ref|YP_001142245.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MSQNQQGQQALKVGRDPRMLPEYEALRSEINKLSHASRPEVDWLKIHRLASLIFEKHGVDLQTAIYFTLA
RSRLQGLNGFTEGCEFLANLIVTQWESFWPPVHQERARIEMLDWFIARISDVIRQYQISHEDKRLVYRCE
RALQLISEKLHNVGLSRIPRVENLVHFIEGYTHLFDETEIVIVSDEPGLKEELQIPPMVFFKSDMEHDSP
SSSAPSSSTPHLPQGSILIGREKGQVKPTVLKIEQHRKQRPAWFWFGCGLLSCALPVMGWLGWQHQQQEK
TVAAQRLQQPAAELPRALSYDDIRQARIVLGEQTLQGMESELVSRYQAQLGRLEQTSPLYWYRYGEGLRN
SLQMLYPDSLAVKALGKQWQTALAGQQGDVVSVPTYLDARAGVDALLDQLLELERQRKTVTISYLKSQLY
EVQKNLMQDIPFSLRLSELEARKASQEPVTAAELKGLENDLKALNIRLYQLQQSSAGS
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2617118-2615682 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGTCACAGAATCAACAAGGTCAGCAGGCGCTGAAAGTGGGGCGCGATCCTCGCATGTTGCCGGAATACG
AGGCGTTGCGCAGCGAGATCAACAAACTCAGCCACGCCTCCCGCCCCGAGGTGGACTGGCTCAAGATCCA
TCGGCTCGCGAGCCTTATCTTTGAAAAGCACGGGGTGGACCTGCAGACCGCCATCTACTTCACCCTGGCG
CGGTCGCGCCTGCAAGGGCTGAACGGCTTTACCGAAGGGTGCGAGTTTCTGGCCAACCTGATAGTGACCC
AGTGGGAGAGCTTCTGGCCACCTGTGCATCAGGAGCGAGCCCGTATCGAGATGCTGGACTGGTTCATTGC
CCGTATCAGCGACGTGATCCGCCAGTACCAGATCAGCCACGAAGACAAGCGCCTCGTCTATCGCTGCGAG
CGGGCGCTGCAACTTATCAGCGAGAAGCTGCACAACGTGGGCTTGAGCCGTATTCCCCGGGTTGAAAATC
TGGTGCACTTCATCGAGGGGTATACCCATCTGTTTGATGAGACCGAGATCGTCATCGTCTCCGATGAGCC
CGGTCTCAAGGAGGAGCTGCAGATCCCGCCCATGGTGTTCTTCAAGTCCGACATGGAGCACGACAGCCCT
TCTTCTTCAGCGCCCTCTTCCAGCACGCCACACCTGCCCCAGGGCAGCATACTGATTGGTCGCGAGAAGG
GGCAGGTCAAACCCACAGTGCTCAAAATTGAACAGCACCGCAAGCAGCGGCCCGCCTGGTTCTGGTTTGG
CTGTGGTCTGCTCAGCTGCGCCCTGCCTGTGATGGGCTGGCTTGGCTGGCAACATCAGCAGCAGGAGAAA
ACAGTGGCTGCCCAGCGCTTGCAGCAACCGGCCGCCGAGTTGCCACGGGCTCTCAGTTATGACGATATCC
GCCAGGCGCGCATCGTACTGGGCGAACAGACCCTGCAAGGCATGGAAAGCGAGCTGGTGTCCCGTTATCA
AGCCCAGCTGGGACGGCTTGAGCAGACCTCGCCGCTCTACTGGTATCGCTATGGGGAAGGGCTGCGCAAC
TCGCTGCAGATGCTCTATCCCGACTCGCTGGCGGTCAAGGCGCTGGGCAAGCAGTGGCAGACGGCGTTGG
CAGGTCAGCAGGGGGATGTGGTCAGCGTACCGACCTATCTGGATGCTCGCGCCGGTGTCGACGCCTTGCT
CGATCAGCTGCTGGAGCTGGAGCGTCAGCGCAAGACGGTGACCATCTCCTATCTCAAGTCCCAGCTCTAT
GAGGTGCAGAAAAACCTGATGCAGGATATCCCGTTCAGTCTGCGCCTGAGCGAACTGGAGGCGAGAAAGG
CATCCCAGGAGCCCGTCACGGCAGCCGAGCTGAAAGGTCTGGAGAACGACCTGAAAGCACTCAATATCCG
CCTCTACCAGTTGCAGCAGAGCAGTGCAGGCAGTTGA